SLC35C1 Antibody - BSA Free

Western Blot: SLC35C1 Antibody [NBP2-85749] - Host: Rabbit. Target Name: SLC35C1. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC35C1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC35C1 Antibody - BSA Free (NBP2-85749) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC35C1. Peptide sequence: VNACILFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAIGYVTG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC35C1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC35C1 Antibody - BSA Free

• CDG2C
• FLJ11320
• FLJ14841
• FUCT1GDP-fucose transporter 1
• Solute carrier family 35 member C1
• solute carrier family 35, member C1

Background

The SLC35C1 gene encodes a GDP-fucose transporter that is found in the Golgi apparatus. Mutations in this gene result in congenital disorder of glycosylation type IIc. Multiple transcript variants encoding different isoforms have been found for this gene. (provi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC35C1