SLC35C1 Antibody

Images

 
Western Blot: SLC35C1 Antibody [NBP2-85749] - Host: Rabbit. Target Name: SLC35C1. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC35C1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC35C1. Peptide sequence: VNACILFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAIGYVTG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SLC35C1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC35C1 Antibody

  • CDG2C
  • FLJ11320
  • FLJ14841
  • FUCT1GDP-fucose transporter 1
  • Solute carrier family 35 member C1
  • solute carrier family 35, member C1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86126
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59130
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010559-P01
Species: Hu
Applications: ELISA, AP, PA, WB
DDX0390P-100
Species: Hu, Mu
Applications: B/N, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vivo
DSFPD0
Species: Hu
Applications: ELISA
NBP2-45641
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
137-PS
Species: Hu
Applications: BA
BBA16
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
AF6796
Species: Hu
Applications: ICC, Simple Western, WB
NB500-526
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
236-EG
Species: Hu
Applications: BA
MAB64091
Species: Hu
Applications: ICC, WB
NBP1-33424
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP1-59069
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-03965
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-33320
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP2-85749
Species: Hu
Applications: WB

Publications for SLC35C1 Antibody (NBP2-85749) (0)

There are no publications for SLC35C1 Antibody (NBP2-85749).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC35C1 Antibody (NBP2-85749) (0)

There are no reviews for SLC35C1 Antibody (NBP2-85749). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC35C1 Antibody (NBP2-85749) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC35C1 Products

Bioinformatics Tool for SLC35C1 Antibody (NBP2-85749)

Discover related pathways, diseases and genes to SLC35C1 Antibody (NBP2-85749). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC35C1 Antibody (NBP2-85749)

Discover more about diseases related to SLC35C1 Antibody (NBP2-85749).
 

Pathways for SLC35C1 Antibody (NBP2-85749)

View related products by pathway.

PTMs for SLC35C1 Antibody (NBP2-85749)

Learn more about PTMs related to SLC35C1 Antibody (NBP2-85749).

Blogs on SLC35C1

There are no specific blogs for SLC35C1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC35C1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC35C1