SLC35A3 Antibody


Immunohistochemistry-Paraffin: SLC35A3 Antibody [NBP1-86458] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

SLC35A3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SSRSVLSPVVGTDAPDQHLELKKPQELKEMERLPLANEDKTMF
Specificity of human SLC35A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC35A3 Protein (NBP1-86458PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC35A3 Antibody

  • DKFZp781P1297
  • Golgi UDP-GlcNAc transporter
  • member 3
  • member A3
  • solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter)
  • Solute carrier family 35 member A3
  • UDP-N-acetylglucosamine transporter


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, ELISA, S-ELISA
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC, KD
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for SLC35A3 Antibody (NBP1-86458) (0)

There are no publications for SLC35A3 Antibody (NBP1-86458).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC35A3 Antibody (NBP1-86458) (0)

There are no reviews for SLC35A3 Antibody (NBP1-86458). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC35A3 Antibody (NBP1-86458) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SLC35A3 Products

Bioinformatics Tool for SLC35A3 Antibody (NBP1-86458)

Discover related pathways, diseases and genes to SLC35A3 Antibody (NBP1-86458). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC35A3 Antibody (NBP1-86458)

Discover more about diseases related to SLC35A3 Antibody (NBP1-86458).

Pathways for SLC35A3 Antibody (NBP1-86458)

View related products by pathway.

PTMs for SLC35A3 Antibody (NBP1-86458)

Learn more about PTMs related to SLC35A3 Antibody (NBP1-86458).

Blogs on SLC35A3

There are no specific blogs for SLC35A3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC35A3 Antibody and receive a gift card or discount.


Gene Symbol SLC35A3