SLC35A3 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC35A3 Antibody [NBP1-86458] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC35A3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSRSVLSPVVGTDAPDQHLELKKPQELKEMERLPLANEDKTMF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC35A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC35A3 Protein (NBP1-86458PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC35A3 Antibody

  • DKFZp781P1297
  • Golgi UDP-GlcNAc transporter
  • member 3
  • member A3
  • solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter)
  • Solute carrier family 35 member A3
  • UDP-N-acetylglucosamine transporter

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-16115
Species: Hu
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-06724
Species: Hu
AF6490
Species: Hu
Applications: WB, IHC, ICC
H00054659-M02
Species: Hu
Applications: WB, ELISA
NBP1-69412
Species: Hu
Applications: WB
NBP2-20803
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4876
Species: Hu
Applications: WB
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP2-13329
Species: Hu
Applications: IHC, IHC-P
NBP1-62518
Species: Hu
Applications: WB, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78911
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for SLC35A3 Antibody (NBP1-86458) (0)

There are no publications for SLC35A3 Antibody (NBP1-86458).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC35A3 Antibody (NBP1-86458) (0)

There are no reviews for SLC35A3 Antibody (NBP1-86458). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC35A3 Antibody (NBP1-86458) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC35A3 Products

Bioinformatics Tool for SLC35A3 Antibody (NBP1-86458)

Discover related pathways, diseases and genes to SLC35A3 Antibody (NBP1-86458). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC35A3 Antibody (NBP1-86458)

Discover more about diseases related to SLC35A3 Antibody (NBP1-86458).
 

Pathways for SLC35A3 Antibody (NBP1-86458)

View related products by pathway.

PTMs for SLC35A3 Antibody (NBP1-86458)

Learn more about PTMs related to SLC35A3 Antibody (NBP1-86458).

Blogs on SLC35A3

There are no specific blogs for SLC35A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC35A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC35A3