SLC34A3 Antibody


Western Blot: SLC34A3 Antibody [NBP1-79995] - Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

SLC34A3 Antibody Summary

Synthetic peptide directed towards the middle region of human SLC34A3. Peptide sequence LLERLSELALGAASLTPRAQAPDILKVLTKPLTHLIVQLDSDMIMSSATG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against SLC34A3 and was validated on Western blot.
Theoretical MW
63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC34A3 Antibody

  • Na(+)/Pi cotransporter 2C
  • Na(+)-dependent phosphate cotransporter 2C
  • naPi-2c
  • sodium-phosphate transport protein 2C
  • solute carrier family 34 (sodium phosphate), member 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Po
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IP, DirELISA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for SLC34A3 Antibody (NBP1-79995) (0)

There are no publications for SLC34A3 Antibody (NBP1-79995).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC34A3 Antibody (NBP1-79995) (0)

There are no reviews for SLC34A3 Antibody (NBP1-79995). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC34A3 Antibody (NBP1-79995) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC34A3 Products

Bioinformatics Tool for SLC34A3 Antibody (NBP1-79995)

Discover related pathways, diseases and genes to SLC34A3 Antibody (NBP1-79995). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC34A3 Antibody (NBP1-79995)

Discover more about diseases related to SLC34A3 Antibody (NBP1-79995).

Pathways for SLC34A3 Antibody (NBP1-79995)

View related products by pathway.

PTMs for SLC34A3 Antibody (NBP1-79995)

Learn more about PTMs related to SLC34A3 Antibody (NBP1-79995).

Blogs on SLC34A3

There are no specific blogs for SLC34A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC34A3 Antibody and receive a gift card or discount.


Gene Symbol SLC34A3