SLC34A3 Antibody - BSA Free

Western Blot: SLC34A3 Antibody [NBP1-79976] - Host: Rabbit. Target Name: SLC34A3. Sample Tissue: Human 293T Whole Cell. Antibody Dilution: 1ug/ml

Western Blot: SLC34A3 Antibody [NBP1-79976] - Human Lung lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC34A3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human SLC34A3. Peptide sequence GDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC34A3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC34A3 Antibody - BSA Free

• Na(+)/Pi cotransporter 2C
• Na(+)-dependent phosphate cotransporter 2C
• naPi-2c
• sodium-phosphate transport protein 2C
• solute carrier family 34 (sodium phosphate), member 3

Background

SLC34A3 contributes to the maintenance of inorganic phosphate (Pi) concentration at the kidney (Segawa et al., 2002(PubMed 11880379)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC34A3
• Uniprot:
  • NP_543153(Human)