SLC34A1 Antibody

Images

 
Western Blot: SLC34A1 Antibody [NBP2-13328] - Analysis in human kidney tissue.
Immunohistochemistry-Paraffin: SLC34A1 Antibody [NBP2-13328] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC34A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLPVPGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPC GEVLERHEPLPAKLALEEEQKPESRLVPKLRQA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC34A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC34A1 Protein (NBP2-13328PEP)
Publications
Read Publications using
NBP2-13328 in the following applications:

  • 2 publications
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26751835), Rat reactivity reported in scientific literature (PMID: 25790436)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC34A1 Antibody

  • FRTS2
  • Na(+)/Pi cotransporter 2A
  • Na(+)-dependent phosphate cotransporter 2A
  • naPi-2a
  • NAPI-3
  • NPT2NPHLOP1
  • NPTIIa
  • renal sodium-dependent phosphate transporter
  • SLC11
  • SLC17A2Na+-phosphate cotransporter type II
  • Sodium/phosphate cotransporter 2A
  • sodium/phosphate co-transporter
  • sodium-dependent phosphate transport protein 2A
  • Sodium-phosphate transport protein 2A
  • solute carrier family 17 (sodium phosphate), member 2
  • solute carrier family 34 (sodium phosphate), member 1
  • Solute carrier family 34 member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
2629-FG/CF
Species: Mu
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP1-81933
Species: Hu
Applications: IHC, IHC-P
NB300-536
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP, IF
8090-ZN
Species: Hu
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00006575-M04
Species: Hu
Applications: WB, ELISA
27570002
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-81013
Species: Hu
Applications: IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NBP1-76511
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13328
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SLC34A1 Antibody (NBP2-13328)(4)

Reviews for SLC34A1 Antibody (NBP2-13328) (0)

There are no reviews for SLC34A1 Antibody (NBP2-13328). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC34A1 Antibody (NBP2-13328) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC34A1 Products

Bioinformatics Tool for SLC34A1 Antibody (NBP2-13328)

Discover related pathways, diseases and genes to SLC34A1 Antibody (NBP2-13328). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC34A1 Antibody (NBP2-13328)

Discover more about diseases related to SLC34A1 Antibody (NBP2-13328).
 

Pathways for SLC34A1 Antibody (NBP2-13328)

View related products by pathway.

PTMs for SLC34A1 Antibody (NBP2-13328)

Learn more about PTMs related to SLC34A1 Antibody (NBP2-13328).

Blogs on SLC34A1.

SLC34A1 - major regulator of inorganic phosphate (Pi) homeostasis
SLC34A1 encodes the 69 kDa sodium-dependent phosphate transport protein 2A (Npt2a). SLC34A is a member of the type II sodium-phosphate co-transporter family, along with SLC34A3 which encodes Npt2c. These proteins are abundantly expressed along the...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC34A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC34A1