SLC34A1 Antibody - BSA Free

Images

 
Immunohistochemistry-Paraffin: SLC34A1 Antibody [NBP2-13328] - Staining of human stomach shows no positivity in glandular cells as expected.
Immunohistochemistry: SLC34A1 Antibody [NBP2-13328] - Immunohistochemical analysis of the apical (closed arrows) and intracellular (open arrows) NaPi-2a (SLC34A1) expression in the kidney. Image collected and cropped by ...read more
Immunohistochemistry-Paraffin: SLC34A1 Antibody [NBP2-13328] - Staining of human kidney shows moderate cytoplasmic and luminal membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: SLC34A1 Antibody [NBP2-13328] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemistry-Paraffin: SLC34A1 Antibody [NBP2-13328] - Staining of human prostate shows no positivity in glandular cells as expected.
Immunohistochemical analysis of the apical (closed arrows) and intracellular (open arrows) NaPi-2a expression in the kidney.
Staining of human cell line HEL shows localization to nuclear speckles, plasma membrane & mitotic spindle.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

SLC34A1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: PLPVPGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC34A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
SLC34A1 Protein (NBP2-13328PEP)
Publications
Read Publications using
NBP2-13328 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26751835), Rat reactivity reported in scientific literature (PMID: 25790436).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SLC34A1 Antibody - BSA Free

  • FRTS2
  • Na(+)/Pi cotransporter 2A
  • Na(+)-dependent phosphate cotransporter 2A
  • naPi-2a
  • NAPI-3
  • NPT2NPHLOP1
  • NPTIIa
  • renal sodium-dependent phosphate transporter
  • SLC11
  • SLC17A2Na+-phosphate cotransporter type II
  • Sodium/phosphate cotransporter 2A
  • sodium/phosphate co-transporter
  • sodium-dependent phosphate transport protein 2A
  • Sodium-phosphate transport protein 2A
  • solute carrier family 17 (sodium phosphate), member 2
  • solute carrier family 34 (sodium phosphate), member 1
  • Solute carrier family 34 member 1

Background

The SLC34A1 gene encodes a member of the type II sodium-phosphate cotransporter family. Mutations in this gene are associated with hypophosphatemia nephrolithiasis/osteoporosis 1. Alternative splicing results in multiple transcript variants. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7665
Species: Hu
Applications: IHC, WB
MAB26291
Species: Mu
Applications: IHC
AF4709
Species: Mu
Applications: IP, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-86713
Species: Hu
Applications: IHC,  IHC-P
NBP1-81933
Species: Hu
Applications: IHC,  IHC-P
8090-ZN
Species: Hu
Applications: EnzAct
MAB8400
Species: Hu
Applications: CyTOF-ready, Flow, WB
H00006575-M04
Species: Hu, Mu
Applications: ELISA, WB
NBP1-32252
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81013
Species: Hu
Applications: IHC,  IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-82574
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, PAGE
AF1819
Species: Mu
Applications: ELISA, IHC, WB

Publications for SLC34A1 Antibody (NBP2-13328)(10)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 4 applications: IF/IHC, IHC-P, Immunocytochemistry/ Immunofluorescence, WB.


Filter By Application
IF/IHC
(1)
IHC-P
(3)
Immunocytochemistry/ Immunofluorescence
(1)
WB
(4)
All Applications
Filter By Species
Human
(1)
Mouse
(4)
Rat
(3)
All Species
Showing Publications 1 - 10 of 10.
Publications using NBP2-13328 Applications Species
Feger M, Alber J, Strotmann J et al. Short-term fasting of mice elevates circulating fibroblast growth factor 23 (FGF23) Acta physiologica (Oxford, England) 2023-09-25 [PMID: 37746883] (WB, Rat) WB Rat
Huang B, Zeng Z, Li H et al. Modeling kidney development, disease, and plasticity with clonal expandable nephron progenitor cells and nephron organoids bioRxiv 2023-05-26 [PMID: 37293038] (Immunocytochemistry/ Immunofluorescence, Human) Immunocytochemistry/ Immunofluorescence Human
Shin S, Boadi EA, Bandyopadhyay BC Ablation of TRPC3 compromises bicarbonate and phosphate transporter activity in mice proximal tubular cells Clinical and experimental pharmacology & physiology 2022-11-26 [PMID: 36433745]
Balzer MS, Doke T, Yang YW et al. Single-cell analysis highlights differences in druggable pathways underlying adaptive or fibrotic kidney regeneration Nature communications 2022-07-11 [PMID: 35821371] (IHC-P, Mouse) IHC-P Mouse
Maruyama H, Taguchi A et al. Low bone mineral density due to secondary hyperparathyroidism in the GlatmTg(CAG-A4GALT) mouse model of Fabry disease. FASEB Bioadv 2020-01-06 [PMID: 32617522] (IF/IHC, WB, Mouse) IF/IHC, WB Mouse
Ter Braake AD, Smit AE, Bos C, et al. Magnesium prevents vascular calcification in Klotho deficiency Kidney Int. 2019-11-02 [PMID: 31866113] (WB, Mouse) WB Mouse
Mace ML, Gravesen E, Nordholm A et al. Kidney fibroblast growth factor 23 does not contribute to elevation of its circulating levels in uremia. Kidney Int. 2017-03-21 [PMID: 28341272] (WB, Rat) WB Rat
Suzuki T, Seki S, Hiramoto K et al. Hyperactivation of Nrf2 in early tubular development induces nephrogenic diabetes insipidus. Nat Commun. 2017-02-24 [PMID: 28233855]
Liu ES, Martins JS, Raimann A et al. 1,25-Dihydroxyvitamin D Alone Improves Skeletal Growth, Microarchitecture and Strength in a Murine Model of XLH, Despite Enhanced FGF23 Expression. J. Bone Miner. Res. 2016-01-11 [PMID: 26751835] (IHC-P, Mouse) IHC-P Mouse
Robijn S, Vervaet BA, D'Haese PC, Verhulst A. Evaluation of intestinal phosphate binding to improve the safety profile of oral sodium phosphate bowel cleansing. PLoS ONE. 2015-03-20 [PMID: 25790436] (IHC-P, Rat) IHC-P Rat

Reviews for SLC34A1 Antibody (NBP2-13328) (0)

There are no reviews for SLC34A1 Antibody (NBP2-13328). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC34A1 Antibody (NBP2-13328) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC34A1 Products

Research Areas for SLC34A1 Antibody (NBP2-13328)

Find related products by research area.

Blogs on SLC34A1.

SLC34A1 - major regulator of inorganic phosphate (Pi) homeostasis
SLC34A1 encodes the 69 kDa sodium-dependent phosphate transport protein 2A (Npt2a). SLC34A is a member of the type II sodium-phosphate co-transporter family, along with SLC34A3 which encodes Npt2c. These proteins are abundantly expressed along the...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC34A1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC34A1