Novus Biologicals products are now on bio-techne.com

SLC26A4 Antibody

Images

 
Western Blot: SLC26A4 Antibody [NBP2-88291] - Host: Rabbit. Target Name: SLC26A4. Sample Tissue: Mouse Skeletal Muscle lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

SLC26A4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse SLC26A4. Peptide sequence: NVFSGFFSCFVATTALSRTAVQESTGGKTQVAGLISAVIVMVAIVALGRL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SLC26A4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for SLC26A4 Antibody

  • DFNB4
  • EVA
  • PDSTDH2B
  • pendrin
  • Sodium-independent chloride/iodide transporter
  • Solute carrier family 26 member 4
  • solute carrier family 26, member 4

Background

Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the SLC26A3 gene. The encoded protein has homology to sulfate transporters. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP1-80670
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-84450
Species: Hu, Mu
Applications: IHC-WhMt, IHC, IHC-P, WB
NBP1-59791
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-49271
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-49409
Species: Hu
Applications: IHC, IHC-P
288-TPN/CF
Species: Hu
Applications: BA
NBP2-47273
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-61141
Species: Hu
Applications: ICC/IF, IHC
NBP1-86856
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-44270
Species: Ca, Hu, Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-32767
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-04922
Species: Hu
Applications: ICC/IF, WB

Publications for SLC26A4 Antibody (NBP2-88291) (0)

There are no publications for SLC26A4 Antibody (NBP2-88291).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC26A4 Antibody (NBP2-88291) (0)

There are no reviews for SLC26A4 Antibody (NBP2-88291). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC26A4 Antibody (NBP2-88291) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC26A4 Products

Research Areas for SLC26A4 Antibody (NBP2-88291)

Find related products by research area.

Blogs on SLC26A4

There are no specific blogs for SLC26A4, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC26A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC26A4