SLC26A11 Antibody - Azide and BSA Free

Western Blot: SLC26A11 Antibody [NBP2-93243] - Analysis of extracts of various cell lines, using SLC26A11 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC26A11 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit SLC26A11 Antibody - Azide and BSA Free (NBP2-93243) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human SLC26A11 (NP_001159819.1). EILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQKQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQEPGTQPYNIREDSILDQK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC26A11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SLC26A11 Antibody - Azide and BSA Free

• MGC46523
• sodium-independent sulfate anion transporter
• Solute carrier family 26 member 11
• solute carrier family 26, member 11

Background

The SLC26A11 gene encodes a member of the solute linked carrier 26 family of anion exchangers. Members of this family ofproteins are essential for numerous cellular functions including homeostasis and intracellular electrolyte balance.The encoded protein is a sod

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SLC26A11