SLC25A31 Antibody


Immunocytochemistry/ Immunofluorescence: SLC25A31 Antibody [NBP1-89074] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: SLC25A31 Antibody [NBP1-89074] - Staining of human cerebellum shows distinct nuclear positivity in purkinje cells and cells in molecular layer.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

SLC25A31 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:FARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYRA
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC25A31 Protein (NBP1-89074PEP)
Read Publication using NBP1-89074.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC25A31 Antibody

  • AAC4DKFZp434N1235
  • adenine nucleotide translocase 4
  • Adenine nucleotide translocator 4
  • ADP
  • ADP/ATP translocase 4
  • ANT 4
  • ANT4DKFZP434N1235
  • ATP carrier protein 4
  • SFEC
  • SFEC35kDa
  • solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 31
  • Solute carrier family 25 member 31
  • Sperm flagellar energy carrier protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for SLC25A31 Antibody (NBP1-89074)(1)

Reviews for SLC25A31 Antibody (NBP1-89074) (0)

There are no reviews for SLC25A31 Antibody (NBP1-89074). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC25A31 Antibody (NBP1-89074) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC25A31 Products

Bioinformatics Tool for SLC25A31 Antibody (NBP1-89074)

Discover related pathways, diseases and genes to SLC25A31 Antibody (NBP1-89074). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A31 Antibody (NBP1-89074)

Discover more about diseases related to SLC25A31 Antibody (NBP1-89074).

Pathways for SLC25A31 Antibody (NBP1-89074)

View related products by pathway.

PTMs for SLC25A31 Antibody (NBP1-89074)

Learn more about PTMs related to SLC25A31 Antibody (NBP1-89074).

Blogs on SLC25A31

There are no specific blogs for SLC25A31, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC25A31 Antibody and receive a gift card or discount.


Gene Symbol SLC25A31