SLC25A31 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC25A31 Antibody [NBP1-89074] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SLC25A31 Antibody [NBP1-89074] - Staining of human testis shows moderate cytoplasmic positivity in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A31 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYRA
Specificity
Specificity of human SLC25A31 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A31
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC25A31 Recombinant Protein Antigen (NBP1-89074PEP)
Publications
Read Publication using NBP1-89074.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC25A31 Antibody

  • AAC4DKFZp434N1235
  • adenine nucleotide translocase 4
  • Adenine nucleotide translocator 4
  • ADP
  • ADP/ATP translocase 4
  • ANT 4
  • ANT4DKFZP434N1235
  • ATP carrier protein 4
  • SFEC
  • SFEC35kDa
  • solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 31
  • Solute carrier family 25 member 31
  • Sperm flagellar energy carrier protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20393
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-229
Species: Mu, Rt, Ch, Ma, Pm, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-232
Species: Hu, Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF2288
Species: Hu
Applications: WB, Simple Western, IHC, ICC
H00001876-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-87416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBL1-14964
Species: Hu
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-WhMt
NB300-516
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IHC, IHC-P, KD

Publications for SLC25A31 Antibody (NBP1-89074)(1)

Reviews for SLC25A31 Antibody (NBP1-89074) (0)

There are no reviews for SLC25A31 Antibody (NBP1-89074). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC25A31 Antibody (NBP1-89074) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC25A31 Products

Bioinformatics Tool for SLC25A31 Antibody (NBP1-89074)

Discover related pathways, diseases and genes to SLC25A31 Antibody (NBP1-89074). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A31 Antibody (NBP1-89074)

Discover more about diseases related to SLC25A31 Antibody (NBP1-89074).
 

Pathways for SLC25A31 Antibody (NBP1-89074)

View related products by pathway.

PTMs for SLC25A31 Antibody (NBP1-89074)

Learn more about PTMs related to SLC25A31 Antibody (NBP1-89074).

Blogs on SLC25A31

There are no specific blogs for SLC25A31, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A31 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A31