SLC25A31 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SLC25A31 Antibody [NBP1-89073] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SLC25A31 Antibody [NBP1-89073] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC25A31 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DTVRRRMMMQSGEAKRQYKGTLDCFVKIYQHEGISSFFRGAFSNVLRGTGGALVLVLYD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC25A31
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SLC25A31 Protein (NBP1-89073PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC25A31 Antibody - BSA Free

• AAC4DKFZp434N1235
• adenine nucleotide translocase 4
• Adenine nucleotide translocator 4
• ADP
• ADP/ATP translocase 4
• ANT 4
• ANT4DKFZP434N1235
• ATP carrier protein 4
• SFEC
• SFEC35kDa
• solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 31
• Solute carrier family 25 member 31
• Sperm flagellar energy carrier protein

Background

Mitochondrial ADP/ATP carriers, such as SLC25A31, are nuclear-coded mitochondrial proteins that catalyze the exchangeof ATP generated in mitochondria by ATP synthase (see MIM 108729) against ADP produced in cytosol by mostenergy-consuming reactions (Dolce et al., 2005 (PubMed 15670820)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A31