SLC25A24 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC25A24 Antibody [NBP1-89049] - Staining of human cell line A-431 shows positivity in cytoplasm and mitochondria.
Immunohistochemistry-Paraffin: SLC25A24 Antibody [NBP1-89049] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC25A24 Antibody [NBP1-89049] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Product Details

Summary
Product Discontinued
View other related SLC25A24 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-89049
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SLC25A24 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A24
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC25A24 Antibody

  • APC1calcium-binding mitochondrial carrier protein SCaMC-1
  • calcium-binding transporter
  • DKFZp586G0123
  • MCSC1
  • Mitochondrial ATP-Mg/Pi carrier protein 1
  • mitochondrial ATP-Mg/Pi transporter
  • Mitochondrial Ca(2+)-dependent solute carrier protein 1
  • SCAMC1
  • SCAMC-1
  • short calcium-binding mitochondrial carrier 1
  • Small calcium-binding mitochondrial carrier protein 1
  • solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24
  • Solute carrier family 25 member 24

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP2-20389
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77376
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-01128
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4497
Species: Hu
Applications: WB, Simple Western
NBP1-82886
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-77155
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77157
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-89093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89020
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-45493
Species: Hu, Mk
Applications: WB, IHC, IF
NBP2-56924
Species: Hu
Applications: ICC/IF
AF1620
Species: Mu
Applications: WB, IHC
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90136
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SLC25A24 Antibody (NBP1-89049) (0)

There are no publications for SLC25A24 Antibody (NBP1-89049).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A24 Antibody (NBP1-89049) (0)

There are no reviews for SLC25A24 Antibody (NBP1-89049). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC25A24 Antibody (NBP1-89049) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC25A24 Products

Bioinformatics Tool for SLC25A24 Antibody (NBP1-89049)

Discover related pathways, diseases and genes to SLC25A24 Antibody (NBP1-89049). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A24 Antibody (NBP1-89049)

Discover more about diseases related to SLC25A24 Antibody (NBP1-89049).
 

Pathways for SLC25A24 Antibody (NBP1-89049)

View related products by pathway.

Blogs on SLC25A24

There are no specific blogs for SLC25A24, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A24 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A24