SLC25A18 Antibody (2F12) - Azide and BSA Free

Western Blot: SLC25A18 Antibody (2F12) [H00083733-M02] - Detection against Immunogen (32.45 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2F12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC25A18 Antibody (2F12) - Azide and BSA Free Summary

• Immunogen: SLC25A18 (NP_113669, 124 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EMLKIQLQDAGRLAVHHQGSASAPSTSRSYTTGSASTHRRPSATLIAWELLRTQGLAGLYR
• Specificity: SLC25A18 - solute carrier family 25 (mitochondrial carrier), member 18 (2F12)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC25A18
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC25A18 Antibody (2F12) - Azide and BSA Free

• GC-2
• GC2Glutamate/H(+) symporter 2
• mitochondrial glutamate carrier 2
• solute carrier family 25 (mitochondrial carrier), member 18
• Solute carrier family 25 member 18

Background

SLC25A18 - solute carrier family 25 (mitochondrial carrier), member 18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A18
• Entrez:
  • 83733(Human)
• Uniprot:
  • NP_113669(Human)