GCAP3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GCAP3 Antibody [NBP1-91930] - Staining of human cell line RPTEC TERT1 shows localization to focal adhesion sites.
Immunohistochemistry: GCAP3 Antibody [NBP1-91930] - Staining of human colon shows moderate membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GCAP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFIDFLEFIAAVNLIMQE
Specificity
Specificity of human GCAP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GUCA1C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GCAP3 Protein (NBP1-91930PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GCAP3 Antibody

  • GCAP3GCAP 3
  • guanylate cyclase activator 1CMGC120159
  • guanylyl cyclase-activating protein 3
  • MGC120158

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55158
Species: Hu
Applications: IHC, IHC-P
NBP2-68721
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000251-M07
Species: Hu
Applications: WB, ELISA, IHC-P, IP, RNAi
NBP1-84880
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24535
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, Single Cell Western
H00083733-Q01
Species: Hu
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-33897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-58940
Species: Hu
Applications: WB, ICC/IF
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97491
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
H00005956-R02
Species: Hu
NBP1-91930
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GCAP3 Antibody (NBP1-91930) (0)

There are no publications for GCAP3 Antibody (NBP1-91930).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCAP3 Antibody (NBP1-91930) (0)

There are no reviews for GCAP3 Antibody (NBP1-91930). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GCAP3 Antibody (NBP1-91930) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GCAP3 Antibody (NBP1-91930)

Discover related pathways, diseases and genes to GCAP3 Antibody (NBP1-91930). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCAP3 Antibody (NBP1-91930)

Discover more about diseases related to GCAP3 Antibody (NBP1-91930).
 

Pathways for GCAP3 Antibody (NBP1-91930)

View related products by pathway.

PTMs for GCAP3 Antibody (NBP1-91930)

Learn more about PTMs related to GCAP3 Antibody (NBP1-91930).

Blogs on GCAP3

There are no specific blogs for GCAP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCAP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GUCA1C