Recombinant Human SLC25A15 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SLC25A15 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 237-301 of Human SLC25A15

Source: Wheat Germ (in vitro)

Amino Acid Sequence: IQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAY

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC25A15
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
32.89 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC25A15 GST (N-Term) Protein

  • D13S327
  • mitochondrial ornithine transporter 1
  • ORC1
  • ornithine transporter 1
  • ORNT1HHH
  • solute carrier family 25 (mitochondrial carrier; ornithine transporter) member15
  • Solute carrier family 25 member 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-09473
Species: Hu
Applications: WB
NBP2-15837
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00004999-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31132
Species: Hu
Applications: ICC/IF, WB
H00023594-M04
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NBP1-82476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB100-2567
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB100-1923
Species: Ce
Applications: IHC, IHC-P, IP, WB
H00004176-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
NB100-796
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-33105
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-75569
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87408
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-56506
Species: Ma, Hu, Mar, Mu, Rt
Applications: ChIP, CyTOF-ready, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for SLC25A15 Partial Recombinant Protein (H00010166-Q01) (0)

There are no publications for SLC25A15 Partial Recombinant Protein (H00010166-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A15 Partial Recombinant Protein (H00010166-Q01) (0)

There are no reviews for SLC25A15 Partial Recombinant Protein (H00010166-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A15 Partial Recombinant Protein (H00010166-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC25A15 Products

Bioinformatics Tool for SLC25A15 Partial Recombinant Protein (H00010166-Q01)

Discover related pathways, diseases and genes to SLC25A15 Partial Recombinant Protein (H00010166-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A15 Partial Recombinant Protein (H00010166-Q01)

Discover more about diseases related to SLC25A15 Partial Recombinant Protein (H00010166-Q01).
 

Pathways for SLC25A15 Partial Recombinant Protein (H00010166-Q01)

View related products by pathway.

Blogs on SLC25A15

There are no specific blogs for SLC25A15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC25A15 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A15