SLC23A2 Antibody - BSA Free

Western Blot: SLC23A2 Antibody [NBP2-94907] - Analysis of various lysates using SLC23A2 Rabbit pAb at 1:5000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 60s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC23A2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC23A2 Antibody - BSA Free (NBP2-94907) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human SLC23A2 (NP_005107.4). MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQDNEDTELMAIYTTENGIAEKSSLAETLDSTGSLDPQRSDMIYTIEDVPP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC23A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Western Blot 1:2500 - 1:10000
• Theoretical MW: 70 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC23A2 Antibody - BSA Free

• KIAA0238SLC23A1
• Na(+)/L-ascorbic acid transporter 2
• Nucleobase transporter-like 1 protein
• Sodium-dependent vitamin C transporter 2
• sodium-dependent vitamin C transporter-2
• solute carrier family 23 (nucleobase transporters), member 1
• solute carrier family 23 (nucleobase transporters), member 2
• solute carrier family 23 member 2
• SVCT2NBTL1
• Yolk sac permease-like molecule 2
• YSPL2hSVCT2

Background

The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC23A2