We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SLC22A13 Recombinant Protein Antigen

Images

 
There are currently no images for SLC22A13 Protein (NBP1-82502PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLC22A13 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC22A13.

Source: E. coli

Amino Acid Sequence: PETHGQGLKDTLQDLELGPHPRSPKSVPSEKETEAKGRTSSPGVAFVSSTY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC22A13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82502.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC22A13 Recombinant Protein Antigen

  • OAT10
  • OCTL1
  • OCTL3
  • ORCTL3
  • ORCTL-3
  • Organic cation transporter-like 3
  • organic cationic transporter-like 3
  • organic-cation transporter like 3
  • solute carrier family 22 (organic anion transporter), member 13
  • solute carrier family 22 member 13
  • solute carrier family 22, member 13

Background

SLC22A13, also known as ORCTL3/OCTL1, which is a member of the organic cation/anion/zwitterion transporter family, is highly expressed in the kidney, and to a weaker extent, in the brain, heart, and intestine. A functional study of Xenopus oocytes revealed that ORCTL3 functions in the uptake of urate and nicotinate. ORCTL3 may play a role in cyclosporine A-induced hyperuricemia, because cyclosporine A enhances urate uptake by ORCTL3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00114571-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-59398
Species: Hu
Applications: WB
NBP1-62660
Species: Hu
Applications: IHC,  IHC-P, WB
H00009356-M05
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NBP1-69536
Species: Hu
Applications: WB
H00116085-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-80524
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-92005
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-59656
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP1-87909
Species: Hu
Applications: IHC,  IHC-P
NBP1-06603
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-59811
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-51684
Species: Hu, Mu
Applications: EM, ELISA, Flow, ICC/IF, IHC, WB
NBP1-92396
Species: Hu
Applications: IHC,  IHC-P
NBP2-42202
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-03626
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB

Publications for SLC22A13 Protein (NBP1-82502PEP) (0)

There are no publications for SLC22A13 Protein (NBP1-82502PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC22A13 Protein (NBP1-82502PEP) (0)

There are no reviews for SLC22A13 Protein (NBP1-82502PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC22A13 Protein (NBP1-82502PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC22A13 Products

Blogs on SLC22A13

There are no specific blogs for SLC22A13, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC22A13 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC22A13