SLC19A3 Antibody (3B2) - Azide and BSA Free

Sandwich ELISA: SLC19A3 Antibody (3B2) [H00080704-M07] - Detection limit for recombinant GST tagged SLC19A3 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 3B2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC19A3 Antibody (3B2) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SLC19A3 Antibody (3B2) - Azide and BSA Free (H00080704-M07) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SLC19A3 (NP_079519.1, 191 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PMPKKSMFFHAKPSREIKKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECYSSKR
• Specificity: Reacts with solute carrier family 19, member 3.
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC19A3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC19A3 Antibody (3B2) - Azide and BSA Free

• SLC19A3
• Solute carrier family 19 member 3
• solute carrier family 19, member 3
• thiamine transporter 2
• ThTr2
• ThTr-2

Background

SLC19A3 is a member of the reduced folate family of micronutrient transporter genes.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC19A3
• Entrez:
  • 80704(Human)
• Uniprot:
  • NP_079519(Human)