SLC17A9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC17A9 Antibody [NBP2-57119] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-Fr
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC17A9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KDLILALGVLAQSRPVSRHSRVPWRRLFRKPA
Specificity
Specificity of human SLC17A9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC17A9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Immunohistochemistry reported in scientific literature (PMID: 31810015). Use in Immunohistochemistry-Frozen reported in scientific literature (PMID:32035094).
Control Peptide
SLC17A9 Recombinant Protein Antigen (NBP2-57119PEP)
Publications
Read Publications using
NBP2-57119 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SLC17A9 Antibody

  • C20orf59
  • Chromosome 20 Open Reading Frame 59
  • Solute Carrier Family 17 (Vesicular Nucleotide Transporter), Member 9
  • Solute Carrier Family 17 Member 9
  • Solute Carrier Family 17, Member 9
  • Vesicular Nucleotide Transporter SLC17A9
  • VNUT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
H00001434-M08
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP, KD
H00081502-P01
Species: Hu
Applications: WB
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-49174
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92156
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD
AF6947
Species: Hu
Applications: WB
NB200-333
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-75649
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-61748
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P

Publications for SLC17A9 Antibody (NBP2-57119)(2)

Reviews for SLC17A9 Antibody (NBP2-57119) (0)

There are no reviews for SLC17A9 Antibody (NBP2-57119). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC17A9 Antibody (NBP2-57119) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC17A9 Products

Bioinformatics Tool for SLC17A9 Antibody (NBP2-57119)

Discover related pathways, diseases and genes to SLC17A9 Antibody (NBP2-57119). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC17A9 Antibody (NBP2-57119)

Discover more about diseases related to SLC17A9 Antibody (NBP2-57119).
 

Pathways for SLC17A9 Antibody (NBP2-57119)

View related products by pathway.

Blogs on SLC17A9

There are no specific blogs for SLC17A9, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC17A9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC17A9