SLC17A9 Antibody

Immunocytochemistry/Immunofluorescence: SLC17A9 Antibody [NBP2-57119] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Discontinued

SLC17A9 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KDLILALGVLAQSRPVSRHSRVPWRRLFRKPA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC17A9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Immunohistochemistry reported in scientific literature (PMID: 31810015). Use in Immunohistochemistry-Frozen reported in scientific literature (PMID:32035094).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC17A9 Antibody

• C20orf59
• Chromosome 20 Open Reading Frame 59
• Solute Carrier Family 17 (Vesicular Nucleotide Transporter), Member 9
• Solute Carrier Family 17 Member 9
• Solute Carrier Family 17, Member 9
• Vesicular Nucleotide Transporter SLC17A9
• VNUT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC17A9 Antibody (NBP2-57119)(2)

Publications using NBP2-57119

• Ahn Y, Seo J, Lee EJ et al. ATP-P2X7-Induced Inflammasome Activation Contributes to Melanocyte Death and CD8+ T-Cell Trafficking to the Skin in Vitiligo J. Invest. Dermatol. 2020-02-06 [PMID: 32035094] (IHC-Fr)
• Mizuhara M, Kometani-Gunjigake K, Nakao-Kuroishi K et al. Vesicular nucleotide transporter mediates adenosine triphosphate release in compressed human periodontal ligament fibroblast cells and participates in tooth movement-induced nociception in rats Arch Oral Biol. 2019-11-11 [PMID: 31810015] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: SLC17A9