SLC15A3 Antibody

Immunocytochemistry/Immunofluorescence: SLC15A3 Antibody [NBP2-56960] - Staining of human cell line SiHa shows localization to vesicles.

Product Discontinued

SLC15A3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QSTYVLQGLHLHIPNIFPANPANISVALRAQGSSYTIPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC15A3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC15A3 Antibody

• FLJ26631
• hPTR3
• OCTP
• Osteoclast Transporter
• Peptide Transporter 3
• Peptide/Histidine Transporter 2
• PHT2
• PHT2PTR3
• PTR3
• SLC15A3
• solute carrier family 15 member 3
• solute carrier family 15, member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC15A3