SLA2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLA2 Antibody [NBP2-56708] - Staining of human cell line Hep G2 shows localization to nucleoplasm & the Golgi apparatus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLA2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPG
Specificity
Specificity of human SLA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLA2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLA2 Recombinant Protein Antigen (NBP2-56708PEP)

Reactivity Notes

Mouse 84%, Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SLA2 Antibody

  • C20orf156
  • FLJ21992
  • Modulator of antigen receptor signaling
  • SLAP-2MARS
  • SLAP2MGC49845
  • Src-like adapter protein 2
  • Src-like adapter protein-2
  • src-like-adapter 2
  • Src-like-adaptor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-84556
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24696
Species: Hu
Applications: IHC, IHC-P
MAB1936
Species: Hu
Applications: WB, IP
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-80919
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, IHC-P, CyTOF-ready
NBP1-30881
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
7270-IL/CF
Species: Hu
NB300-731
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NBP1-85540
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-85297
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-03563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for SLA2 Antibody (NBP2-56708) (0)

There are no publications for SLA2 Antibody (NBP2-56708).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLA2 Antibody (NBP2-56708) (0)

There are no reviews for SLA2 Antibody (NBP2-56708). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLA2 Antibody (NBP2-56708) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLA2 Products

Bioinformatics Tool for SLA2 Antibody (NBP2-56708)

Discover related pathways, diseases and genes to SLA2 Antibody (NBP2-56708). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLA2 Antibody (NBP2-56708)

Discover more about diseases related to SLA2 Antibody (NBP2-56708).
 

Pathways for SLA2 Antibody (NBP2-56708)

View related products by pathway.

PTMs for SLA2 Antibody (NBP2-56708)

Learn more about PTMs related to SLA2 Antibody (NBP2-56708).

Blogs on SLA2

There are no specific blogs for SLA2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLA2