Sirtuin 2/SIRT2 Recombinant Protein Antigen

Images

 
There are currently no images for Sirtuin 2/SIRT2 Protein (NBP1-87039PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Sirtuin 2/SIRT2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SIRT2.

Source: E. coli

Amino Acid Sequence: KDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SIRT2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87039.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Sirtuin 2/SIRT2 Recombinant Protein Antigen

  • EC 3.5.1
  • EC 3.5.1.-
  • FLJ35621
  • FLJ37491
  • S.cerevisiae, homolog) 2
  • SIR2L2
  • SIRT2
  • Sirtuin 2
  • sirtuin type 2

Background

Silent information regulator 2 (Sir2) family of enzymes has been implicated in many cellular processes that include histone deacetylation, gene silencing, chromosomal stability, and aging. O-acetyl-ADP-ribose causes a delay/block in oocyte maturation and results in a delay/block in embryo cell division in blastomeres. It has been demonstrated that the production of O-acetyl-ADP-ribose is evolutionarily conserved among Sir2-like enzymes from yeast, Drosophila, and human. Also, endogenous yeast Sir2 complex from telomeres was shown to generate O-acetyl-ADP-ribose (1). SIRT2 is a predominantly cytoplasmic protein that colocalizes with microtubules. SIRT2 deacetylates lysine-40 of alpha-tubulin both in vitro and in vivo. Knockdown of SIRT2 via siRNA results in tubulin hyperacetylation. SIRT2 colocalizes and interacts in vivo with HDAC6, another tubulin deacetylase (2). Cytoskeleton-related protein, SIRT2 is down-regulated in gliomas, and data suggests that ectopic expression of SIRT2 in glioma cell lines led to the perturbation of the microtubule network (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-52563
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC-WhMt, IHC,  IHC-P, WB
NBP3-46113
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
NBL1-11570
Species: Hu
Applications: WB
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
Applications: WB
AF5215
Species: Hu, Mu
Applications: ICC, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NB100-56745
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, WB
AF4888
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP2-14998
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NB100-1669
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-87039PEP
Species: Hu
Applications: AC

Publications for Sirtuin 2/SIRT2 Protein (NBP1-87039PEP) (0)

There are no publications for Sirtuin 2/SIRT2 Protein (NBP1-87039PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sirtuin 2/SIRT2 Protein (NBP1-87039PEP) (0)

There are no reviews for Sirtuin 2/SIRT2 Protein (NBP1-87039PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Sirtuin 2/SIRT2 Protein (NBP1-87039PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sirtuin 2/SIRT2 Products

Research Areas for Sirtuin 2/SIRT2 Protein (NBP1-87039PEP)

Find related products by research area.

Blogs on Sirtuin 2/SIRT2

There are no specific blogs for Sirtuin 2/SIRT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Sirtuin 2/SIRT2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SIRT2