SIRP beta 1/CD172b Antibody

Images

 
Immunohistochemistry-Paraffin: SIRPB1 Antibody [NBP2-13310] Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SIRP beta 1/CD172b Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VSKSYALEISAHQKEHGSDITHEPALAPTAPL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIRPB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SIRP beta 1/CD172b Protein (NBP2-13310PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SIRP beta 1/CD172b Antibody

  • CD172 antigen-like family member B
  • CD172b antigen
  • CD172b
  • DKFZp686A05192
  • FLJ26614
  • signal-regulatory protein beta 1
  • signal-regulatory protein beta-1
  • SIRP beta 1
  • SIRPB1
  • SIRP-beta-1 isoform 3
  • SIRP-BETA-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7307
Species: Rt
Applications: WB, Flow, CyTOF-ready, Neut
MAB5240
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-31106
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF4486
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-55403
Species: Hu
Applications: WB, PEP-ELISA
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-16456
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13310
Species: Hu
Applications: IHC, IHC-P

Publications for SIRP beta 1/CD172b Antibody (NBP2-13310) (0)

There are no publications for SIRP beta 1/CD172b Antibody (NBP2-13310).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIRP beta 1/CD172b Antibody (NBP2-13310) (0)

There are no reviews for SIRP beta 1/CD172b Antibody (NBP2-13310). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SIRP beta 1/CD172b Antibody (NBP2-13310) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SIRP beta 1/CD172b Products

Bioinformatics Tool for SIRP beta 1/CD172b Antibody (NBP2-13310)

Discover related pathways, diseases and genes to SIRP beta 1/CD172b Antibody (NBP2-13310). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIRP beta 1/CD172b Antibody (NBP2-13310)

Discover more about diseases related to SIRP beta 1/CD172b Antibody (NBP2-13310).
 

Pathways for SIRP beta 1/CD172b Antibody (NBP2-13310)

View related products by pathway.

PTMs for SIRP beta 1/CD172b Antibody (NBP2-13310)

Learn more about PTMs related to SIRP beta 1/CD172b Antibody (NBP2-13310).

Blogs on SIRP beta 1/CD172b

There are no specific blogs for SIRP beta 1/CD172b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIRP beta 1/CD172b Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIRPB1
Entrez