SIRP beta 1/CD172b Antibody


Immunohistochemistry-Paraffin: SIRPB1 Antibody [NBP2-13310] Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

SIRP beta 1/CD172b Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VSKSYALEISAHQKEHGSDITHEPALAPTAPL
Specificity of human SIRP beta 1/CD172b antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SIRP beta 1/CD172b Protein (NBP2-13310PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SIRP beta 1/CD172b Antibody

  • CD172 antigen-like family member B
  • CD172b antigen
  • CD172b
  • DKFZp686A05192
  • FLJ26614
  • signal-regulatory protein beta 1
  • signal-regulatory protein beta-1
  • SIRP beta 1
  • SIRPB1
  • SIRP-beta-1 isoform 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS, ICC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for SIRP beta 1/CD172b Antibody (NBP2-13310) (0)

There are no publications for SIRP beta 1/CD172b Antibody (NBP2-13310).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIRP beta 1/CD172b Antibody (NBP2-13310) (0)

There are no reviews for SIRP beta 1/CD172b Antibody (NBP2-13310). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SIRP beta 1/CD172b Antibody (NBP2-13310) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SIRP beta 1/CD172b Products

Bioinformatics Tool for SIRP beta 1/CD172b Antibody (NBP2-13310)

Discover related pathways, diseases and genes to SIRP beta 1/CD172b Antibody (NBP2-13310). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIRP beta 1/CD172b Antibody (NBP2-13310)

Discover more about diseases related to SIRP beta 1/CD172b Antibody (NBP2-13310).

Pathways for SIRP beta 1/CD172b Antibody (NBP2-13310)

View related products by pathway.

PTMs for SIRP beta 1/CD172b Antibody (NBP2-13310)

Learn more about PTMs related to SIRP beta 1/CD172b Antibody (NBP2-13310).

Blogs on SIRP beta 1/CD172b

There are no specific blogs for SIRP beta 1/CD172b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SIRP beta 1/CD172b Antibody and receive a gift card or discount.


Gene Symbol SIRPB1