Recombinant Human Sin1/MAPKAP1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Sin1/MAPKAP1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 51-160 of Human Sin1/MAPKAP1

Source: Wheat Germ

Amino Acid Sequence: GSEIQGSNGETQGYVYAQSVDITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQSILSVRLEQCPLQLNNPFNEY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MAPKAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Sin1/MAPKAP1 Protein

  • JC310
  • MAPKAP1
  • MEKK2-interacting protein 1
  • MGC2745
  • MIP1
  • MIP1SIN1SIN1b
  • Mitogen-activated protein kinase 2-associated protein 1
  • mitogen-activated protein kinase associated protein 1
  • mSIN1
  • ras inhibitor MGC2745
  • SAPK-interacting protein 1
  • Sin1
  • SIN1g
  • stress-activated map kinase interacting protein 1
  • Stress-activated map kinase-interacting protein 1
  • stress-activated protein kinase-interacting 1
  • target of rapamycin complex 2 subunit MAPKAP1
  • TORC2 subunit MAPKAP1

Background

MAPKAP1 - mitogen-activated protein kinase associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-612
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-331
Species: Hu, Mu, Rt
Applications: WB
AF4004
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-89865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24503
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-20308
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-58661
Species: Hu
Applications: IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Sin1/MAPKAP1 Partial Recombinant Protein (H00079109-Q01) (0)

There are no publications for Sin1/MAPKAP1 Partial Recombinant Protein (H00079109-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sin1/MAPKAP1 Partial Recombinant Protein (H00079109-Q01) (0)

There are no reviews for Sin1/MAPKAP1 Partial Recombinant Protein (H00079109-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sin1/MAPKAP1 Partial Recombinant Protein (H00079109-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sin1/MAPKAP1 Products

Bioinformatics Tool for Sin1/MAPKAP1 Partial Recombinant Protein (H00079109-Q01)

Discover related pathways, diseases and genes to Sin1/MAPKAP1 Partial Recombinant Protein (H00079109-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sin1/MAPKAP1 Partial Recombinant Protein (H00079109-Q01)

Discover more about diseases related to Sin1/MAPKAP1 Partial Recombinant Protein (H00079109-Q01).
 

Pathways for Sin1/MAPKAP1 Partial Recombinant Protein (H00079109-Q01)

View related products by pathway.

PTMs for Sin1/MAPKAP1 Partial Recombinant Protein (H00079109-Q01)

Learn more about PTMs related to Sin1/MAPKAP1 Partial Recombinant Protein (H00079109-Q01).
 

Research Areas for Sin1/MAPKAP1 Partial Recombinant Protein (H00079109-Q01)

Find related products by research area.

Blogs on Sin1/MAPKAP1

There are no specific blogs for Sin1/MAPKAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Rictor Antibody
NB100-612

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Sin1/MAPKAP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPKAP1
Entrez