Signal sequence receptor delta Recombinant Protein Antigen

Images

 
There are currently no images for Signal sequence receptor delta Protein (NBP1-92390PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Signal sequence receptor delta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SSR4.

Source: E. coli

Amino Acid Sequence: TPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SSR4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92390.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Signal sequence receptor delta Recombinant Protein Antigen

  • signal sequence receptor, delta (translocon-associated protein delta)
  • SSR-delta
  • translocon-associated protein delta
  • translocon-associated protein subunit delta
  • TRAP-delta
  • TRAPDSignal sequence receptor subunit delta

Background

SSR4, also called TRAPD, is assumed to be involved in protein secretion. It is located in the Xq28 region, arranged in a compact head-to-head manner with the IDH3G gene. These two genes are driven by a bidirectional promoter located between them, and encode proteins involved in unrelated biochemical pathways located in different compartments of the cell. The nontranscribed intergenic region represents only 133 bp and is embedded in a CpG island. The CpG island functions as a bidirectional promoter to initiate the transcription of both functionally unrelated genes with distinct expression patterns. SSR4 consists of six exons and is approximately 70 kb telomeric to the ALD gene. Although alternative splicing of exon 5 has not been detected in human SSR4, transcript variants missing the region homologous to human exon 5 have been detected in both Xenopus laevis and Mus musculus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: ICC/IF, IHC,  IHC-P, IP, PLA, WB
NBP1-86094
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00005696-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
AF1007
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-22356
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
7027-GT
Species: Hu, Wf
Applications: EnzAct
NBP3-42972
Species: Hu
Applications: ELISA, IHC, WB
NBP3-32868
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-86471
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-46439
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-47535
Species: Hu
Applications: ELISA, IHC, WB
NBP1-91780
Species: Hu
Applications: IHC,  IHC-P
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-05024
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-84022
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-10379
Species: Hu
Applications: IHC, WB
H00010488-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, S-ELISA, WB
NBP2-13419
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15238
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB

Publications for Signal sequence receptor delta Protein (NBP1-92390PEP) (0)

There are no publications for Signal sequence receptor delta Protein (NBP1-92390PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Signal sequence receptor delta Protein (NBP1-92390PEP) (0)

There are no reviews for Signal sequence receptor delta Protein (NBP1-92390PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Signal sequence receptor delta Protein (NBP1-92390PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Signal sequence receptor delta Products

Research Areas for Signal sequence receptor delta Protein (NBP1-92390PEP)

Find related products by research area.

Blogs on Signal sequence receptor delta

There are no specific blogs for Signal sequence receptor delta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Signal sequence receptor delta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SSR4