Siglec-6/CD327 Antibody

Images

 
Western Blot: Siglec-6/CD327 Antibody [H00000946-B01P] - Analysis of SIGLEC6 expression in transfected 293T cell line by SIGLEC6 polyclonal antibody. Lane 1: SIGLEC6 transfected lysate(48.07 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Siglec-6/CD327 Antibody Summary

Immunogen
SIGLEC6 (ENSP00000344064, 1 a.a. - 437 a.a.) full-length human protein. MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SIGLEC6
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Siglec-6/CD327 Antibody

  • CD327 antigen
  • CD327
  • CD33 antigen-like 1
  • CD33L1
  • CD33L1OBBP1CD327
  • CD33L2
  • CD33LCDW327
  • CDw327
  • OB-BP1
  • Obesity-binding protein 1
  • sialic acid binding Ig-like lectin 6
  • sialic acid-binding Ig-like lectin 6
  • Siglec6
  • Siglec-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
AF1668
Species: Hu
Applications: WB, IP
AF1072
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF842
Species: Hu
Applications: WB
AF856
Species: Mu
Applications: WB, Flow, CyTOF-ready, Neut
AF165
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Siglec-6/CD327 Antibody (H00000946-B01P) (0)

There are no publications for Siglec-6/CD327 Antibody (H00000946-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Siglec-6/CD327 Antibody (H00000946-B01P) (0)

There are no reviews for Siglec-6/CD327 Antibody (H00000946-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Siglec-6/CD327 Antibody (H00000946-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Siglec-6/CD327 Products

Bioinformatics Tool for Siglec-6/CD327 Antibody (H00000946-B01P)

Discover related pathways, diseases and genes to Siglec-6/CD327 Antibody (H00000946-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Siglec-6/CD327 Antibody (H00000946-B01P)

Discover more about diseases related to Siglec-6/CD327 Antibody (H00000946-B01P).
 

Pathways for Siglec-6/CD327 Antibody (H00000946-B01P)

View related products by pathway.

PTMs for Siglec-6/CD327 Antibody (H00000946-B01P)

Learn more about PTMs related to Siglec-6/CD327 Antibody (H00000946-B01P).

Blogs on Siglec-6/CD327

There are no specific blogs for Siglec-6/CD327, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Siglec-6/CD327 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIGLEC6
Entrez
Uniprot