Siglec-2/CD22 Recombinant Protein Antigen

Images

 
There are currently no images for Siglec-2/CD22 Protein (NBP1-87041PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Siglec-2/CD22 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD22.

Source: E. coli

Amino Acid Sequence: DLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD22
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87041.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Siglec-2/CD22 Recombinant Protein Antigen

  • B-cell receptor CD22
  • BL-CAM
  • B-lymphocyte cell adhesion molecule
  • CD22 antigenMGC130020
  • CD22 molecule
  • CD22
  • sialic acid binding Ig-like lectin 2
  • Sialic acid-binding Ig-like lectin 2
  • Siglec2
  • Siglec-2
  • SIGLEC2FLJ22814
  • T-cell surface antigen Leu-14

Background

CD22 is a single-pass type 1 membrane glycoprotein found in the cytoplasm and cell membrane of B-lymphocytes. CD22 has at least two isoforms (alpha and beta) produced by alternate splicing. The protein exists predominantly as a monomer of the beta isoform (95 kDa). It is also found as a heterodimer of the beta and alpha isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
NBP2-70360
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC,  IHC-P, WB
NBP2-22377
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
AF5129
Species: Hu
Applications: WB
NBP1-83276
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, ISH, WB
AF123
Species: Hu
Applications: Block, ICC, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
DR2A00
Species: Hu
Applications: ELISA
H00003669-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-25200
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB

Publications for Siglec-2/CD22 Protein (NBP1-87041PEP) (0)

There are no publications for Siglec-2/CD22 Protein (NBP1-87041PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Siglec-2/CD22 Protein (NBP1-87041PEP) (0)

There are no reviews for Siglec-2/CD22 Protein (NBP1-87041PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Siglec-2/CD22 Protein (NBP1-87041PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in buying a CD22 antibody for fluorescence microscopy and FACS I red on your web page that you also offer to label your antibodies, if required, is that correct?
    • We do have the ability to perform custom conjugations on certain antibodies, including some to the CD22 protein. If you send me the conjugate you are interested in I can provide you with a quote.

Additional Siglec-2/CD22 Products

Research Areas for Siglec-2/CD22 Protein (NBP1-87041PEP)

Find related products by research area.

Blogs on Siglec-2/CD22.

Antigen-loss relapse after successful CAR-T therapy; What do we do now?
By Jacqueline Carrico, BS, MD Tumor cell mechanisms driving tolerance to CAR-T Despite very promising results of CAR-T therapy in acute lymphoblastic leukemia, B-ALL, antigen-loss relapse has arisen as a major chall...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Siglec-2/CD22 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD22