Siglec-10 Antibody (1D11)

Images

 
Sandwich ELISA: Siglec-10 Antibody (1D11) [H00089790-M01] - Detection limit for recombinant GST tagged SIGLEC10 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Siglec-10 Antibody (1D11) Summary

Immunogen
SIGLEC10 (NP_149121, 589 a.a. ~ 697 a.a) partial recombinant protein with GST tag.SRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPS PESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNF PGVRPRPEARMPKGTQADYAEVKF
Localization
Isoforms 1-4: Cell membrane; Single-pass type I membrane protein. Isoform 5: secreted.
Specificity
SIGLEC10 - sialic acid binding Ig-like lectin 10
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SIGLEC10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Siglec-10 Antibody (1D11)

  • MGC126774
  • PRO940
  • sialic acid binding Ig-like lectin 10
  • sialic acid-binding Ig-like lectin 10
  • Siglec10
  • Siglec-10
  • siglec-like gene 2
  • Siglec-like protein 2
  • SLG2
  • SLG2sialic acid binding Ig-like lectin 10 Ig-like lectin 7

Background

SIGLECs are members of the immunoglobulin superfamily that are expressed on the cell surface. Most SIGLECs have 1 or more cytoplasmic immune receptor tyrosine-based inhibitory motifs, or ITIMs. SIGLECs are typically expressed on cells of the innate immune system, with the exception of the B-cell expressed SIGLEC6 (MIM 604405).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67321
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB10721
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31141
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1139
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
H00004068-M01
Species: Hu
Applications: WB, ELISA
NB100-77903
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-89671
Species: Hu
Applications: WB, IHC, IHC-P
MAB7775
Species: Mu
Applications: Flow, CyTOF-ready
MAB7775
Species: Mu
Applications: Flow, CyTOF-ready
NBP1-88317
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
MAB3811
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00089790-M01
Species: Hu
Applications: WB, ELISA

Publications for Siglec-10 Antibody (H00089790-M01) (0)

There are no publications for Siglec-10 Antibody (H00089790-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Siglec-10 Antibody (H00089790-M01) (0)

There are no reviews for Siglec-10 Antibody (H00089790-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Siglec-10 Antibody (H00089790-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Siglec-10 Antibody (H00089790-M01)

Discover related pathways, diseases and genes to Siglec-10 Antibody (H00089790-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Siglec-10 Antibody (H00089790-M01)

Discover more about diseases related to Siglec-10 Antibody (H00089790-M01).
 

Pathways for Siglec-10 Antibody (H00089790-M01)

View related products by pathway.

PTMs for Siglec-10 Antibody (H00089790-M01)

Learn more about PTMs related to Siglec-10 Antibody (H00089790-M01).

Blogs on Siglec-10

There are no specific blogs for Siglec-10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Siglec-10 Antibody (1D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol SIGLEC10
Entrez
OMIM
Uniprot