Siglec-10 Antibody (1D11) Summary
Immunogen |
SIGLEC10 (NP_149121, 589 a.a. ~ 696 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRPRPEARMPKGTQADYAEVKF |
Localization |
Isoforms 1-4: Cell membrane; Single-pass type I membrane protein. Isoform 5: secreted. |
Specificity |
SIGLEC10 - sialic acid binding Ig-like lectin 10 |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
SIGLEC10 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Siglec-10 Antibody (1D11)
Background
SIGLECs are members of the immunoglobulin superfamily that are expressed on the cell surface. Most SIGLECs have 1 or more cytoplasmic immune receptor tyrosine-based inhibitory motifs, or ITIMs. SIGLECs are typically expressed on cells of the innate immune system, with the exception of the B-cell expressed SIGLEC6 (MIM 604405).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, Neut
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: BA
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
Species: Bv, Ca, Hu, Mu, Rb, Rt, Sh
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Eq, Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
Publications for Siglec-10 Antibody (H00089790-M01) (0)
There are no publications for Siglec-10 Antibody (H00089790-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Siglec-10 Antibody (H00089790-M01) (0)
There are no reviews for Siglec-10 Antibody (H00089790-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Siglec-10 Antibody (H00089790-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Siglec-10 Products
Bioinformatics Tool for Siglec-10 Antibody (H00089790-M01)
Discover related pathways, diseases and genes to Siglec-10 Antibody (H00089790-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Siglec-10 Antibody (H00089790-M01)
Discover more about diseases related to Siglec-10 Antibody (H00089790-M01).
| | Pathways for Siglec-10 Antibody (H00089790-M01)
View related products by pathway.
|
PTMs for Siglec-10 Antibody (H00089790-M01)
Learn more about PTMs related to Siglec-10 Antibody (H00089790-M01).
| | Research Areas for Siglec-10 Antibody (H00089790-M01)
Find related products by research area.
|
Blogs on Siglec-10