SIAH2 Antibody - Azide and BSA Free

Western Blot: SIAH2 Antibody [NBP2-93257] - Analysis of extracts of SKOV3 cells, using SIAH2 .Exposure time: 5min.

Product Discontinued

SIAH2 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SIAH2 (NP_005058.3). VCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIAH2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID:32798288)

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SIAH2 Antibody - Azide and BSA Free

• E3 ubiquitin-protein ligase SIAH2
• EC 6.3.2
• EC 6.3.2.-
• hSiah2
• seven in absentia (Drosophila) homolog 2
• seven in absentia homolog 2 (Drosophila)
• Seven in absentia homolog 2
• siah-2

Background

The Drosophila SINA (seven in absentia) protein is an E3 ubiquitin ligase component of the RAS signal transduction pathway. The RAS signal pathway controls cell proliferation, differentiation, and survival, and regulation of this pathway is critical for normal development. In Drosophila, SINA serves as a downstream gatekeeper required for proper RAS signal transduction. Similarly to SINA in Drosophila, the human protein SIAH has also been shown to be required for oncogenic RAS signaling in cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for SIAH2 Antibody (NBP2-93257)(1)

Publication using NBP2-93257

• Miao R, Lu Y, He X et al. Ubiquitin-specific protease 19 blunts pathological cardiac hypertrophy via inhibition of the TAK1-dependent pathway J. Cell. Mol. Med. Aug 14 2020 [PMID: 32798288] (WB, Mouse)

Bioinformatics

• Gene Symbol: SIAH2