Recombinant Human SHOX2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SHOX2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 117-204 of Human SHOX2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK

Protein/Peptide Type
Partial Recombinant Protein
Gene
SHOX2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SHOX2 Protein

  • Homeobox protein Og12X
  • OG12SHOX homologous gene on chromosome 3
  • OG12Xshort stature homeobox protein 2
  • short stature homeobox 2
  • SHOTPaired-related homeobox protein SHOT

Background

SHOX2 - short stature homeobox 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55181
Species: Hu
Applications: ICC/IF
H00023499-M08
Species: Hu
Applications: WB, ELISA
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
AF482
Species: Mu
Applications: WB, IHC
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-92334
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55843
Species: Hu
Applications: ICC/IF
NBP1-90010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00056899-P01
Species: Hu
NBP2-00714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1404
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
H00006474-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SHOX2 Partial Recombinant Protein (H00006474-Q01) (0)

There are no publications for SHOX2 Partial Recombinant Protein (H00006474-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHOX2 Partial Recombinant Protein (H00006474-Q01) (0)

There are no reviews for SHOX2 Partial Recombinant Protein (H00006474-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SHOX2 Partial Recombinant Protein (H00006474-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SHOX2 Products

Bioinformatics Tool for SHOX2 Partial Recombinant Protein (H00006474-Q01)

Discover related pathways, diseases and genes to SHOX2 Partial Recombinant Protein (H00006474-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHOX2 Partial Recombinant Protein (H00006474-Q01)

Discover more about diseases related to SHOX2 Partial Recombinant Protein (H00006474-Q01).
 

Pathways for SHOX2 Partial Recombinant Protein (H00006474-Q01)

View related products by pathway.

PTMs for SHOX2 Partial Recombinant Protein (H00006474-Q01)

Learn more about PTMs related to SHOX2 Partial Recombinant Protein (H00006474-Q01).

Blogs on SHOX2

There are no specific blogs for SHOX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SHOX2 Antibody (1D1)
H00006474-M01
FGF-10 [Unconjugated]
345-FG-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SHOX2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SHOX2