SHC1 Antibody (3F4) - Azide and BSA Free

Western Blot: SHC1 Antibody (3F4) [H00006464-M01] - SHC1 monoclonal antibody (M01), clone 3F4 Analysis of SHC1 expression in A-431.

Immunocytochemistry/Immunofluorescence: SHC1 Antibody (3F4) [H00006464-M01] - Analysis of monoclonal antibody to SHC1 on A-431 cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: SHC1 Antibody (3F4) [H00006464-M01] - Analysis of monoclonal antibody to SHC1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1 ug/ml.

Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01] - Protein-protein interactions between STAT5A and SHC1 Mahlavu cells were stained with anti-STAT5A rabbit purified polyclonal 1:1200 and anti-SHC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01] - Analysis of protein-protein interactions between PIK3R1 and SHC1. HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-SHC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01] - Analysis of protein-protein interactions between PIK3R1 and SHC1. Huh7 cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-SHC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

ELISA: SHC1 Antibody (3F4) [H00006464-M01] - Detection limit for recombinant GST tagged SHC1 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, Func, ICC/IF, IHC
• Clone: 3F4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SHC1 Antibody (3F4) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SHC1 (AAH33925, 171 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLS
• Specificity: SHC1 - SHC (Src homology 2 domain containing) transforming protein 1
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SHC1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SHC1 Antibody (3F4) - Azide and BSA Free

• FLJ26504
• p66
• p66SHC
• SH2 domain protein C1
• SHC (Src homology 2 domain containing) transforming protein 1
• SHC (Src homology 2 domain-containing) transforming protein 1
• SHC
• SHC1
• SHCA
• SHC-transforming protein 1
• SHC-transforming protein 3
• SHC-transforming protein A
• Src homology 2 domain-containing-transforming protein C1

Background

Signaling adapter that couples activated growth factor receptors to signaling pathway. Isoform p46Shc andisoform p52Shc, once phosphorylated, couple activated receptor tyrosine kinases to Ras via the recruitment of theGRB2/SOS complex and are implicated in the cytoplasmic propagation of mitogenic signals. Isoform p46Shc and isoformp52Shc may thus function as initiators of the Ras signaling cascade in various non-neuronal systems. Isoform p66Shcdoes not mediate Ras activation, but is involved in signal transduction pathways that regulate the cellular responseto oxidative stress and life span. Isoform p66Shc acts as a downstream target of the tumor suppressor p53 and isindispensable for the ability of stress-activated p53 to induce elevation of intracellular oxidants, cytochrome crelease and apoptosis. The expression of isoform p66Shc has been correlated with life span

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SHC1 Antibody (H00006464-M01)(2)

Publications using H00006464-M01

• Cao Q, Shi Y, Wang X et al. Circular METRN RNA hsa_circ_0037251 Promotes Glioma Progression by Sponging miR-1229-3p and Regulating mTOR Expression. Sci Rep. 2019-12-24 [PMID: 31875034]
• Doebele RC, Davis LE, Vaishnavi A et al. An oncogenic NTRK fusion in a soft tissue sarcoma patient with response to the tropomyosin-related kinase (TRK) inhibitor LOXO-101. Cancer Discov. 2015-07-27 [PMID: 26216294] (PLA, Human)

Bioinformatics

• Gene Symbol: SHC1
• Entrez:
  • 6464(Human)
• OMIM:
  • 600560(Human)
• Uniprot:
  • AAH33925(Human)