SHC1 Antibody (3F4)

Images

 
Western Blot: SHC1 Antibody (3F4) [H00006464-M01] - SHC1 monoclonal antibody (M01), clone 3F4 Analysis of SHC1 expression in A-431.
Immunocytochemistry/ Immunofluorescence: SHC1 Antibody (3F4) [H00006464-M01] - Analysis of monoclonal antibody to SHC1 on A-431 cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: SHC1 Antibody (3F4) [H00006464-M01] - Analysis of monoclonal antibody to SHC1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1 ug/ml.
Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01] - Protein-protein interactions between STAT5A and SHC1 Mahlavu cells were stained with anti-STAT5A rabbit purified polyclonal 1:1200 and anti-SHC1 mouse ...read more
Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01] - Analysis of protein-protein interactions between PIK3R1 and SHC1. HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-SHC1 ...read more
Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01] - Analysis of protein-protein interactions between PIK3R1 and SHC1. Huh7 cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-SHC1 ...read more
ELISA: SHC1 Antibody (3F4) [H00006464-M01] - Detection limit for recombinant GST tagged SHC1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, PLA
Clone
3F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SHC1 Antibody (3F4) Summary

Immunogen
SHC1 (AAH33925 171 a.a. - 280 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLS
Specificity
SHC1 - SHC (Src homology 2 domain containing) transforming protein 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SHC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publication using
H00006464-M01 in the following applications:

  • PLA
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SHC1 Antibody (3F4)

  • FLJ26504
  • p66
  • p66SHC
  • SH2 domain protein C1
  • SHC (Src homology 2 domain containing) transforming protein 1
  • SHC (Src homology 2 domain-containing) transforming protein 1
  • SHC
  • SHC1
  • SHCA
  • SHC-transforming protein 1
  • SHC-transforming protein 3
  • SHC-transforming protein A
  • Src homology 2 domain-containing-transforming protein C1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB38461
Species: Hu
Applications: WB, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2988
Species: Mu, Rt
Applications: WB
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA

Publications for SHC1 Antibody (H00006464-M01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: PLA.


Filter By Application
PLA
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SHC1 Antibody (H00006464-M01) (0)

There are no reviews for SHC1 Antibody (H00006464-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SHC1 Antibody (H00006464-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHC1 Products

Bioinformatics Tool for SHC1 Antibody (H00006464-M01)

Discover related pathways, diseases and genes to SHC1 Antibody (H00006464-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHC1 Antibody (H00006464-M01)

Discover more about diseases related to SHC1 Antibody (H00006464-M01).
 

Pathways for SHC1 Antibody (H00006464-M01)

View related products by pathway.

PTMs for SHC1 Antibody (H00006464-M01)

Learn more about PTMs related to SHC1 Antibody (H00006464-M01).
 

Research Areas for SHC1 Antibody (H00006464-M01)

Find related products by research area.

Blogs on SHC1

There are no specific blogs for SHC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHC1 Antibody (3F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol SHC1
Entrez
OMIM
Uniprot