SHANK1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SHANK1 Antibody [NBP1-87016] - Staining of human cell line U-2 OS shows localization to plasma membrane.
Immunohistochemistry-Paraffin: SHANK1 Antibody [NBP1-87016] - Staining of human lateral ventricle shows strong positivity in glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SHANK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TVKASIISELSSKLQQFGGSSAAGGALPWARGGSGGGGDSHHGGASYVPERTSSLQRQRLSDDSQSSLLSKPVSSLFQNWPKPPLP
Marker
TGN Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHANK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SHANK1 Protein (NBP1-87016PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SHANK1 Antibody

  • SH3 and multiple ankyrin repeat domains 1
  • SH3 and multiple ankyrin repeat domains protein 1
  • Shank1
  • Somatostatin receptor-interacting protein
  • SSTR-interacting protein
  • SSTRIPSPANK-1
  • synamon

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7035
Species: Hu
Applications: IHC
NBP1-47610
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-44999
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-37582
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-00810
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
AF8100
Species: Hu
Applications: WB, IHC
NBP1-85609
Species: Hu
Applications: IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF

Publications for SHANK1 Antibody (NBP1-87016) (0)

There are no publications for SHANK1 Antibody (NBP1-87016).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SHANK1 Antibody (NBP1-87016) (0)

There are no reviews for SHANK1 Antibody (NBP1-87016). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SHANK1 Antibody (NBP1-87016) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SHANK1 Products

Bioinformatics Tool for SHANK1 Antibody (NBP1-87016)

Discover related pathways, diseases and genes to SHANK1 Antibody (NBP1-87016). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHANK1 Antibody (NBP1-87016)

Discover more about diseases related to SHANK1 Antibody (NBP1-87016).
 

Pathways for SHANK1 Antibody (NBP1-87016)

View related products by pathway.

PTMs for SHANK1 Antibody (NBP1-87016)

Learn more about PTMs related to SHANK1 Antibody (NBP1-87016).
 

Research Areas for SHANK1 Antibody (NBP1-87016)

Find related products by research area.

Blogs on SHANK1

There are no specific blogs for SHANK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SHANK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SHANK1