| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody has been engineered to specifically recognize the recombinant protein SH3BGRL using the following amino acid sequence: IKKKQQDVLGFLEANKIGFEEKDIAANEENRKWMRENVPENSRPATGYPLPPQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSK |
| Predicted Species | Mouse (96%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SH3BGRL |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry Glutaredoxin 3/GLRX3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Glutaredoxin_3_AF7560_Immunohistochemistry_22502.jpg)
![Western Blot Glutaredoxin 3/GLRX3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Glutaredoxin_3_AF7560_Western_Blot_12315.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SH3BGRL Antibody (NBP3-25135)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SH3BGRL |
![Simple Western c-Rel Antibody [Unconjugated]](https://images.novusbio.com/images2/cRel_AF2699_Simple_Western_16940.jpg)
![Western Blot c-Rel Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2699_human-mouse-c-rel-affinity-purified-polyclonal-ab-western-blot-2102024121216..jpg)
![Western Blot STAT2 Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT2_PAFST2_Western_Blot_21973.jpg)
![Knockout Validated STAT2 Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT2_PAFST2_Knockout_Validated_21974.jpg)
![Western Blot STAT2 Antibody [Unconjugated]](https://images.novusbio.com/images/paf-st2_human-stat2-affinity-purified-polyclonal-ab-western-blot-12122025854110.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")