SH3BGRL Antibody - BSA Free Summary
| Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein SH3BGRL using the following amino acid sequence: IKKKQQDVLGFLEANKIGFEEKDIAANEENRKWMRENVPENSRPATGYPLPPQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSK |
| Predicted Species |
Mouse (96%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SH3BGRL |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
|
| Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for SH3BGRL Antibody - BSA Free
Background
SH3BGRL is a gene that codes for a protein measuring 114 amino acids in length and approximately 13 kDa in weight that functions as a SH3 domain-binding glutamic acid-rich-like protein. Current studies are being done on diseases and disorders linked to this gene including endocarditis and obesity. SH3BGRL has also been shown to have interactions with EGFR, ATG5, ERBB2, IL7R, and TPT1 in pathways such as the EGFR1 signaling pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu
Applications: DB, ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Ca, Hu, Po, Pm, Rb
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for SH3BGRL Antibody (NBP3-25135) (0)
There are no publications for SH3BGRL Antibody (NBP3-25135).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SH3BGRL Antibody (NBP3-25135) (0)
There are no reviews for SH3BGRL Antibody (NBP3-25135).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SH3BGRL Antibody (NBP3-25135) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SH3BGRL Products
Research Areas for SH3BGRL Antibody (NBP3-25135)
Find related products by research area.
|
Blogs on SH3BGRL