SH3BGRL Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: FNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA |
| Predicted Species |
Mouse (93%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SH3BGRL |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for SH3BGRL Antibody - BSA Free
Background
SH3BGRL is a gene that codes for a protein measuring 114 amino acids in length and approximately 13 kDa in weight that functions as a SH3 domain-binding glutamic acid-rich-like protein. Current studies are being done on diseases and disorders linked to this gene including endocarditis and obesity. SH3BGRL has also been shown to have interactions with EGFR, ATG5, ERBB2, IL7R, and TPT1 in pathways such as the EGFR1 signaling pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu
Applications: DB, ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Ca, Hu, Po, Pm, Rb
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Bv, Hu, Pm, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Publications for SH3BGRL Antibody (NBP2-33609) (0)
There are no publications for SH3BGRL Antibody (NBP2-33609).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SH3BGRL Antibody (NBP2-33609) (0)
There are no reviews for SH3BGRL Antibody (NBP2-33609).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SH3BGRL Antibody (NBP2-33609) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SH3BGRL Products
Research Areas for SH3BGRL Antibody (NBP2-33609)
Find related products by research area.
|
Blogs on SH3BGRL