Reactivity | HuSpecies Glossary |
Applications | WB, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to PLEKHH2(pleckstrin homology domain containing, family H (with MyTH4 domain) member 2) The peptide sequence was selected from the C terminal of PLEKHH2.
Peptide sequence WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKYAIYCQRCVERTQ The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PLEKHH2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | This is a rabbit polyclonal antibody against PLEKHH2 and was validated on Western blot. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for PLEKHH2 Antibody (NBP1-70677)Discover more about diseases related to PLEKHH2 Antibody (NBP1-70677).
| Pathways for PLEKHH2 Antibody (NBP1-70677)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | PLEKHH2 |