PLEKHH2 Antibody


Western Blot: PLEKHH2 Antibody [NBP1-70677] - Titration: 1 ug/ml Positive Control: Jurkat cell lysate.
Immunohistochemistry: PLEKHH2 Antibody [NBP1-70677] - Staining of human prostate section.
Immunohistochemistry-Paraffin: PLEKHH2 Antibody [NBP1-70677] - Human Heart Tissue, antibody concentration 10ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PLEKHH2 Antibody Summary

Synthetic peptides corresponding to PLEKHH2(pleckstrin homology domain containing, family H (with MyTH4 domain) member 2) The peptide sequence was selected from the C terminal of PLEKHH2. Peptide sequence WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTE
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against PLEKHH2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PLEKHH2 Antibody

  • KIAA2028
  • pleckstrin homology domain containing, family H (with MyTH4 domain) member 2


PLEKHH2 contains 1 FERM domain, 1 MyTH4 domain and 2 PH domains. It is a Single-pass membrane protein. The exact function of PLEKHH2 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu
Applications: WB, ICC
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PLEKHH2 Antibody (NBP1-70677) (0)

There are no publications for PLEKHH2 Antibody (NBP1-70677).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEKHH2 Antibody (NBP1-70677) (0)

There are no reviews for PLEKHH2 Antibody (NBP1-70677). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLEKHH2 Antibody (NBP1-70677) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PLEKHH2 Products

PLEKHH2 NBP1-70677

Bioinformatics Tool for PLEKHH2 Antibody (NBP1-70677)

Discover related pathways, diseases and genes to PLEKHH2 Antibody (NBP1-70677). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLEKHH2 Antibody (NBP1-70677)

Discover more about diseases related to PLEKHH2 Antibody (NBP1-70677).

Pathways for PLEKHH2 Antibody (NBP1-70677)

View related products by pathway.

Blogs on PLEKHH2

There are no specific blogs for PLEKHH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PLEKHH2 Antibody and receive a gift card or discount.


Gene Symbol PLEKHH2