![Western Blot: PLEKHH2 Antibody [NBP1-70677] - Titration: 1 ug/ml Positive Control: Jurkat cell lysate.](http://images.novusbio.com/fullsize2/PLEKHH2-Antibody-Western-Blot-NBP1-70677-img0003.jpg "Western Blot: PLEKHH2 Antibody [NBP1-70677] - Titration: 1 ug/ml Positive Control: Jurkat cell lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptides corresponding to PLEKHH2(pleckstrin homology domain containing, family H (with MyTH4 domain) member 2) The peptide sequence was selected from the C terminal of PLEKHH2.
Peptide sequence WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLEKHH2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against PLEKHH2 and was validated on Western blot. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for PLEKHH2 Antibody (NBP1-70677)Discover more about diseases related to PLEKHH2 Antibody (NBP1-70677).
| Pathways for PLEKHH2 Antibody (NBP1-70677)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PLEKHH2 |
![Immunohistochemistry: PLEKHH2 Antibody [NBP1-70677] - Staining of human prostate section.](http://images.novusbio.com/fullsize2/PLEKHH2-Antibody-Immunohistochemistry-NBP1-70677-img0004.jpg "Immunohistochemistry: PLEKHH2 Antibody [NBP1-70677] - Staining of human prostate section.")
![Immunohistochemistry-Paraffin: PLEKHH2 Antibody [NBP1-70677] - Human Heart Tissue, antibody concentration 10ug/ml.](http://images.novusbio.com/fullsize2/PLEKHH2-Antibody-Immunohistochemistry-Paraffin-NBP1-70677-img0002.jpg "Immunohistochemistry-Paraffin: PLEKHH2 Antibody [NBP1-70677] - Human Heart Tissue, antibody concentration 10ug/ml.")
![Western Blot: Dendrin Antibody [NBP2-37980] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize2/Dendrin Antibody-Western Blot-NBP2-37980-img0002.jpg)
![Immunohistochemistry: Dendrin Antibody [NBP2-37980] - Staining of human kidney shows moderate membranous, cytoplasmic and nuclear positivity in cells in glomeruli.](http://images.novusbio.com/fullsize2/Dendrin-Antibody-Immunohistochemistry-NBP2-37980-img0001.jpg)
![Western Blot: Phenylalanine Hydroxylase Antibody [NBP1-52084] - (0.1ug/ml) staining of Mouse (A) and Rat (B) Liver lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.](http://images.novusbio.com/fullsize2/Phenylalanine Hydroxylase Antibody-Western Blot-NBP1-52084-img0004.jpg)
![Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-52084] - Staining of paraffin embedded Human Kidney. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/fullsize2/Phenylalanine-Hydroxylase-Antibody-Immunohistochemistry-Paraffin-NBP1-52084-img0005.jpg)
![Western Blot: Phenylalanine Hydroxylase Antibody [NBP1-52084] - Analysis of Phenylalanine Hydroxylase Human Liver lysate (35ug protein in RIPA buffer) using this antibody at 0.3 ug/ml. Primary incubation was 1 hour. Detected by chemiluminescence.](http://images.novusbio.com/fullsize2/Phenylalanine Hydroxylase Antibody-Western Blot-NBP1-52084-img0002.jpg)
![Western Blot: EHD3 Antibody (4B7) [H00030845-M01] - EHD3 monoclonal antibody (M01), clone 4B7 Analysis of EHD3 expression in IMR-32.](http://images.novusbio.com/fullsize2/EHD3-Antibody-(4B7)-Western-Blot-H00030845-M01-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: EHD3 Antibody (4B7) [H00030845-M01] - Analysis of monoclonal antibody to EHD3 on HeLa cell. Antibody concentration 25 ug/ml.](http://images.novusbio.com/fullsize2/EHD3-Antibody-(4B7)-Immunocytochemistry-Immunofluorescence-H00030845-M01-img0008.jpg)
![Immunohistochemistry-Paraffin: EHD3 Antibody (4B7) [H00030845-M01] - Analysis of monoclonal antibody to EHD3 on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize2/EHD3-Antibody-(4B7)-Immunohistochemistry-Paraffin-H00030845-M01-img0010.jpg)
![Western Blot: Pleckstrin Antibody (6H8) [NBP2-02300] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Pleckstrin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Pleckstrin.](http://images.novusbio.com/fullsize/Pleckstrin Antibody (6H8)-Western Blot-NBP2-02300-img0002.jpg)
![Immunohistochemistry-Paraffin: Pleckstrin Antibody (6H8) [NBP2-02300] Staining of paraffin-embedded prostate tissue using anti-Pleckstrin mouse monoclonal antibody.](http://images.novusbio.com/fullsize/Pleckstrin Antibody (6H8)-Immunohistochemistry-Paraffin-NBP2-02300-img0007.jpg)
![Flow Cytometry: Pleckstrin Antibody (6H8) [NBP2-02300] - HEK293T cells transfected with either pCMV6-ENTRY Pleckstrin.(Red) or empty vector control plasmid (Blue) were immunostained with anti-Pleckstrin mouse monoclonal, and then analyzed by flow cytometry.](http://images.novusbio.com/fullsize/Pleckstrin Antibody (6H8)-Flow Cytometry-NBP2-02300-img0001.jpg)
![Western Blot: TdT Antibody [NBP2-31368] - WB detection of TDT protein in (A) lysate of MOLT4 human leukemia cell line and (B) partial recombinant protein by using TDT antibody. Primary antibody concentration used: 1 ug/ml for Molt4 lysate, 0.05 ug/ml for recombinant protein.](http://images.novusbio.com/fullsize2/TdT-Antibody-Western-Blot-NBP2-31368-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: TdT Antibody [NBP2-31368] - TdT antibody was tested in A431 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). An antibody concentration of 0.01 ug/ml was used. Image objective 40x.](http://images.novusbio.com/fullsize2/TdT-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31368-img0006.jpg)
![Immunohistochemistry-Paraffin: TdT Antibody [NBP2-31368] - IHC-P analysis of TdT protein in a section of human hepatocellular carcinoma (HCC) using TdT antibody at a concentration of 10 ug/ml. The HCC cells depicted strong nuclear / weak cytoplasmic positivity for TdT immunostaining.](http://images.novusbio.com/fullsize2/TdT-Antibody-Immunohistochemistry-Paraffin-NBP2-31368-img0003.jpg)
![Western Blot: SH2D4A Antibody [NBP1-82157] - Staining in human urinary bladder and testis tissues using anti-SH2D4A antibody. Corresponding SH2D4A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/SH2D4A-Antibody-Western-Blot-NBP1-82157-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: SH2D4A Antibody [NBP1-82157] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.](http://images.novusbio.com/fullsize2/SH2D4A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82157-img0009.jpg)
![Immunohistochemistry-Paraffin: SH2D4A Antibody [NBP1-82157] - Staining of human urinary bladder shows high expression.](http://images.novusbio.com/fullsize2/SH2D4A-Antibody-Immunohistochemistry-Paraffin-NBP1-82157-img0012.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")