Home » PLEKHH2 » PLEKHH2 Antibodies » PLEKHH2 Antibody

PLEKHH2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PLEKHH2 Antibody [NBP1-70677] - Titration: 1 ug/ml Positive Control: Jurkat cell lysate.
Western Blot: PLEKHH2 Antibody [NBP1-70677] - Titration: 1 ug/ml Positive Control: Jurkat cell lysate.
Immunohistochemistry: PLEKHH2 Antibody [NBP1-70677] - Staining of human prostate section.
Immunohistochemistry-Paraffin: PLEKHH2 Antibody [NBP1-70677] - Human Heart Tissue, antibody concentration 10ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PLEKHH2 Antibody Summary

Immunogen
Synthetic peptides corresponding to PLEKHH2(pleckstrin homology domain containing, family H (with MyTH4 domain) member 2) The peptide sequence was selected from the C terminal of PLEKHH2. Peptide sequence WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKYAIYCQRCVERTQ The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLEKHH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PLEKHH2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PLEKHH2 Antibody

  • KIAA2028
  • pleckstrin homology domain containing, family H (with MyTH4 domain) member 2
  • PLEKHH1L

Background

PLEKHH2 contains 1 FERM domain, 1 MyTH4 domain and 2 PH domains. It is a Single-pass membrane protein. The exact function of PLEKHH2 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Dendrin Antibody
NBP3-12389
Dendrin Antibody
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Phenylalanine
Hydroxylase Antibody
NBP2-48615
Western Blot: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Analysis using Anti-PAH antibody NBP2-48615 (A) shows similar pattern to independent antibody NBP1-80917 (B).
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Analysis in human liver and pancreas tissues. Corresponding Phenylalanine Hydroxylase RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Species: Hu
Applications: IHC, IHC-P, WB
EHD3 Antibody
NBP2-31896
Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31896] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31896] - Staining of human liver shows moderate membranous positivity in hepatic sinusoid cells.
Immunohistochemistry-Paraffin: EHD3 Antibody [NBP2-31896] - Staining of human lymphoid tissues shows moderate positivity in reticular fibers in germinal center cells.
(2 Publications)
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(4 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
HIC5/TGFB1I1
Antibody [Unconjugate
AF5626
Western blot shows lysates of MCF‑7 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human HIC5/TGFB1I1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5626) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for HIC5/TGFB1I1 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
HIC5/TGFB1I1 was detected in immersion fixed PC‑3 human prostate cancer cell line, unstimulated (upper panel) or stimulated with 10 ng/mL Recombinant Human BMP-4 (Catalog # 314-BP; lower panel), using Goat Anti-Human HIC5/TGFB1I1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5626) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm (unstimulated) and nuclei (stimulated). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC, WB
Nephrin Antibody
[Unconjugated]
AF3159
Nephrin was detected in perfusion fixed frozen sections of mouse kidney using 10 µg/mL Goat Anti-Mouse Nephrin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3159) overnight at 4 °C. Tissue was stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained (green). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Nephrin was detected in perfusion fixed frozen sections of mouse kidney using Goat Anti-Mouse Nephrin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3159) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(2 Reviews)
(23 Publications)
Species: Mu
Applications: IHC
Pleckstrin Antibody
NB100-1343
Immunohistochemistry-Paraffin: Pleckstrin Antibody [NB100-1343] - Staining of paraffin embedded Human Vessel (platelets). Antibody at 3.75 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: Pleckstrin Antibody [NB100-1343] - Staining of paraffin embedded Human Spleen. Antibody at 3.75 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: Pleckstrin Antibody [NB100-1343] - Staining of Human Parathyroid lysate (A) and negative control HepG2 (B) cell lysate (35ug protein in RIPA buffer). Antibody at 0.01 ug/mL. Detected by chemiluminescence.
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
TdT Antibody
NBP2-31368
Western Blot: TdT Antibody [NBP2-31368] - WB detection of TDT protein in (A) lysate of MOLT4 human leukemia cell line and (B) partial recombinant protein by using TDT antibody. Primary antibody concentration used: 1 ug/ml for Molt4 lysate, 0.05 ug/ml for recombinant protein.
Immunohistochemistry-Paraffin: TdT Antibody [NBP2-31368] - IHC-P analysis of TdT protein in a section of human lung using TdT antibody at a concentration of 10 ug/ml. The alveolar cells of the lungs showed strong nuclear / weak cytoplasmic positivity for TdT immunostaining.
Immunohistochemistry-Paraffin: TdT Antibody [NBP2-31368] - IHC-P analysis of TdT protein in a section of human hepatocellular carcinoma (HCC) using TdT antibody at a concentration of 10 ug/ml. The HCC cells depicted strong nuclear / weak cytoplasmic positivity for TdT immunostaining.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SH2D4A Antibody
NBP1-82157
Immunocytochemistry/Immunofluorescence: SH2D4A Antibody [NBP1-82157] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: SH2D4A Antibody [NBP1-82157] - Staining of human testis shows low expression as expected.
Immunohistochemistry-Paraffin: SH2D4A Antibody [NBP1-82157] - Staining of human urinary bladder shows high expression.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PLEKHH2 Antibody
NBP1-70677
PLEKHH2 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PLEKHH2 Antibody (NBP1-70677) (0)

There are no publications for PLEKHH2 Antibody (NBP1-70677).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEKHH2 Antibody (NBP1-70677) (0)

There are no reviews for PLEKHH2 Antibody (NBP1-70677). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLEKHH2 Antibody (NBP1-70677) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLEKHH2 Products

Bioinformatics Tool for PLEKHH2 Antibody (NBP1-70677)

Discover related pathways, diseases and genes to PLEKHH2 Antibody (NBP1-70677). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLEKHH2 Antibody (NBP1-70677)

Discover more about diseases related to PLEKHH2 Antibody (NBP1-70677).
 

Pathways for PLEKHH2 Antibody (NBP1-70677)

View related products by pathway.

Blogs on PLEKHH2

There are no specific blogs for PLEKHH2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLEKHH2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PLEKHH2