SGK1 Recombinant Protein Antigen

Images

 
There are currently no images for SGK1 Recombinant Protein Antigen (NBP2-56236PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SGK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SGK.

Source: E. coli

Amino Acid Sequence: NILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SGK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56236.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SGK1 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • serine/threonine protein kinase SGK
  • serine/threonine-protein kinase Sgk1
  • serum/glucocorticoid regulated kinase 1
  • serum/glucocorticoid regulated kinase
  • Serum/glucocorticoid-regulated kinase 1
  • SGK
  • SGK1

Background

SGK1 encodes a serine/threonine protein kinase that is highly similar to the rat serum-and glucocorticoid-induced protein kinase (SGK). This gene was identified in a screen of hepatocellular genes regulated in response to cellular hydration or swelling. Cellular hydration is a catabolic signal, stimulating glycogenolysis and proteolysis, and inhibiting protein and glycogen synthesis. This kinase has been shown to be important in activating certain potassium, sodium, and chloride channels. Expression of this gene in hepatocytes is stimulated by transforming growth factor-beta (TGF-beta) which participates in the pathophysiology of diabetic complications. Since both TGF-beta expression and SGK expression are elevated in diabetic nephropathy, this suggests an involvement of SGK in the development of this condition.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF4589
Species: Hu
Applications: IHC, WB
NB100-59014
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P
H00023327-P01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
MAB864
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NB100-2383
Species: Hu
Applications: ICC/IF, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
NB300-562
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-86102
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-82874
Species: Hu
Applications: IHC,  IHC-P
AF8962
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-16521
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, WB

Publications for SGK1 Recombinant Protein Antigen (NBP2-56236PEP) (0)

There are no publications for SGK1 Recombinant Protein Antigen (NBP2-56236PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SGK1 Recombinant Protein Antigen (NBP2-56236PEP) (0)

There are no reviews for SGK1 Recombinant Protein Antigen (NBP2-56236PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SGK1 Recombinant Protein Antigen (NBP2-56236PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SGK1 Products

Research Areas for SGK1 Recombinant Protein Antigen (NBP2-56236PEP)

Find related products by research area.

Blogs on SGK1

There are no specific blogs for SGK1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SGK1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SGK1