SGK2 Antibody

Images

 
Western Blot: SGK2 Antibody [NBP1-86102] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunohistochemistry-Paraffin: SGK2 Antibody [NBP1-86102] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western Blot: SGK2 Antibody [NBP1-86102] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SGK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SGK2 Protein (NBP1-86102PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SGK2 Antibody

  • dJ138B7.2
  • EC 2.7.11
  • EC 2.7.11.1
  • H-SGK2
  • serine/threonine-protein kinase Sgk2
  • serum/glucocorticoid regulated kinase 2
  • Serum/glucocorticoid-regulated kinase 2
  • SGK2
  • Sgkl

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19010
Species: Hu
Applications: WB, IHC, IHC-P
NLS7240
Species: Hu, Mu, Rt, Bt, Ca, Ha
Applications: IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54974
Species: Hu
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-2383
Species: Hu
Applications: WB, ICC/IF
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
H00003738-M01
Species: Hu
Applications: WB, ELISA
NBP2-48740
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84938
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP1-62518
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-60082
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SGK2 Antibody (NBP1-86102) (0)

There are no publications for SGK2 Antibody (NBP1-86102).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SGK2 Antibody (NBP1-86102) (0)

There are no reviews for SGK2 Antibody (NBP1-86102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SGK2 Antibody (NBP1-86102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SGK2 Products

Bioinformatics Tool for SGK2 Antibody (NBP1-86102)

Discover related pathways, diseases and genes to SGK2 Antibody (NBP1-86102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SGK2 Antibody (NBP1-86102)

Discover more about diseases related to SGK2 Antibody (NBP1-86102).
 

Pathways for SGK2 Antibody (NBP1-86102)

View related products by pathway.

PTMs for SGK2 Antibody (NBP1-86102)

Learn more about PTMs related to SGK2 Antibody (NBP1-86102).
 

Research Areas for SGK2 Antibody (NBP1-86102)

Find related products by research area.

Blogs on SGK2

There are no specific blogs for SGK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SGK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SGK2
Entrez