SFRS12IP1 Antibody

Images

 
Western Blot: SFRS12IP1 Antibody [NBP2-47280] - Analysis in control (vector only transfected HEK293T lysate) and SREK1IP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry: SFRS12IP1 Antibody [NBP2-47280] - Immunohistochemical staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SFRS12IP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MAVPGCNKDSVRAGCKKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDS
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SREK1IP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SFRS12IP1 Protein (NBP2-47280PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SFRS12IP1 Antibody

  • MGC131910
  • p18 splicing regulatory protein
  • p18SRP
  • P18SRPMGC150549
  • protein SFRS12IP1
  • protein SREK1IP1
  • SFRS12-interacting protein 1FLJ36754
  • SFRS12IP1
  • Splicing regulatory protein of 18 kDa
  • SREK1-interacting protein 1MGC150548

Background

Possible splicing regulator involved in the control of cellular survival

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87993
Species: Hu
Applications: IHC, IHC-P, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, WB
NBP2-19417
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NB120-14258
Species: Hu, Mu, Rt
Applications: WB
NBP1-89014
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89996
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-82024
Species: Hu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-77209
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
AF6387
Species: Hu
Applications: WB
NBP2-32706
Species: Hu
Applications: IHC, IHC-P, WB
MAB6028
Species: Hu
Applications: WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NB100-64775
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
H00026224-M03
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB

Publications for SFRS12IP1 Antibody (NBP2-47280) (0)

There are no publications for SFRS12IP1 Antibody (NBP2-47280).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFRS12IP1 Antibody (NBP2-47280) (0)

There are no reviews for SFRS12IP1 Antibody (NBP2-47280). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SFRS12IP1 Antibody (NBP2-47280) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SFRS12IP1 Products

Bioinformatics Tool for SFRS12IP1 Antibody (NBP2-47280)

Discover related pathways, diseases and genes to SFRS12IP1 Antibody (NBP2-47280). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SFRS12IP1

There are no specific blogs for SFRS12IP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SFRS12IP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SREK1IP1