sFRP-1 Antibody

Western Blot: sFRP-1 Antibody [NBP2-57336] - Western blot analysis in human cell line RT-4.

Immunocytochemistry/Immunofluorescence: sFRP-1 Antibody [NBP2-57336] - Staining of human cell line SK-MEL-30 shows localization to nucleoli.

Product Discontinued

sFRP-1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDL
• Predicted Species: Mouse (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SFRP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Rat 88%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for sFRP-1 Antibody

• FRP1
• FRP-1FrzA
• FRPSARP-2
• FrzA
• SARP-2
• SARP2sFRP-1
• Secreted apoptosis-related protein 2
• secreted frizzled-related protein 1
• sFRP1
• sFRP-1

Background

SFRP1 (also known as FRP, FRP1, SARP2, Secreted Apoptosis-related Protein 2, Secreted Frizzled-related Protein and Secreted frizzled-related protein 1) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. SFRP1 and SFRP5 may be involved in determining the polarity of photoreceptor cells in the retina. SFRP1 is expressed in several human tissues, with the highest levels in heart.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SFRP1