SF3A2 Recombinant Protein Antigen

Images

 
There are currently no images for SF3A2 Recombinant Protein Antigen (NBP2-48775PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SF3A2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SF3A2.

Source: E. coli

Amino Acid Sequence: EVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SF3A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48775.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SF3A2 Recombinant Protein Antigen

  • pre-mRNA splicing factor SF3A, subunit 2
  • PRP11
  • PRPF11
  • SAP 62
  • SAP62Prp11
  • SF3a66splicing factor 3a, subunit 2, 66kD
  • spliceosome associated protein 62
  • Spliceosome-associated protein 62
  • splicing factor 3A subunit 2
  • splicing factor 3a, subunit 2, 66kDa

Background

SF3A2 encodes subunit 2 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 2 interacts with subunit 1 through its amino-terminus while the single zinc finger domain of subunit 2 plays a role in its binding to the 15S U2 snRNP. Subunit 2 may also function independently of its RNA splicing function as a microtubule-binding protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94076
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87214
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB6207
Species: Hu
Applications: ICC, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
1737-MS
Species: Hu
Applications: Bind
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP3-03409
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-92873
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-88262
Species: Hu
Applications: IHC,  IHC-P, WB
H00010691-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-79848
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB100-57490
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-83218
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-20944
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-74190
Species: Mu
Applications: ChIP, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for SF3A2 Recombinant Protein Antigen (NBP2-48775PEP) (0)

There are no publications for SF3A2 Recombinant Protein Antigen (NBP2-48775PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SF3A2 Recombinant Protein Antigen (NBP2-48775PEP) (0)

There are no reviews for SF3A2 Recombinant Protein Antigen (NBP2-48775PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SF3A2 Recombinant Protein Antigen (NBP2-48775PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SF3A2 Products

Array NBP2-48775PEP

Blogs on SF3A2

There are no specific blogs for SF3A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SF3A2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SF3A2