SF3A2 Antibody (3B6)

Images

 
Western Blot: SF3A2 Antibody (3B6) [H00008175-M01] - SF3A2 expression in NIH/3T3 ( Cat # L018V1 ).
Immunocytochemistry/ Immunofluorescence: SF3A2 Antibody (3B6) [H00008175-M01] - Analysis of monoclonal antibody to SF3A2 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: SF3A2 Antibody (3B6) [H00008175-M01] - SF3A2 expression in PC-12 ( Cat # L012V1 ).
Western Blot: SF3A2 Antibody (3B6) [H00008175-M01] - SF3A2 expression in Hela NE ( Cat # L013V3 ).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP
Clone
3B6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SF3A2 Antibody (3B6) Summary

Immunogen
SF3A2 (NP_009096 112 a.a. - 216 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEK
Specificity
SF3A2 (3B6)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SF3A2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
Application Notes
This antibody reactivity against cell lysate and recombinant protein for WB. It has been useful for IF and ELISA. IP usage reported in scientific literature (PMID: 22672905).
Publications
Read Publication using
H00008175-M01 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SF3A2 Antibody (3B6)

  • pre-mRNA splicing factor SF3A, subunit 2
  • PRP11
  • PRPF11
  • SAP 62
  • SAP62Prp11
  • SF3a66splicing factor 3a, subunit 2, 66kD
  • spliceosome associated protein 62
  • Spliceosome-associated protein 62
  • splicing factor 3A subunit 2
  • splicing factor 3a, subunit 2, 66kDa

Background

This gene encodes subunit 2 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 2 interacts with subunit 1 through its amino-terminus while the single zinc finger domain of subunit 2 plays a role in its binding to the 15S U2 snRNP. Subunit 2 may also function independently of its RNA splicing function as a microtubule-binding protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87212
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79843
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-52501
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-86966
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00079092-T01
Species: Hu
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91949
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-83565
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82623
Species: Hu
Applications: IHC, IHC-P
NBP1-74190
Species: Mu
Applications: WB, ChIP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP

Publications for SF3A2 Antibody (H00008175-M01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SF3A2 Antibody (H00008175-M01) (0)

There are no reviews for SF3A2 Antibody (H00008175-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SF3A2 Antibody (H00008175-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SF3A2 Products

Bioinformatics Tool for SF3A2 Antibody (H00008175-M01)

Discover related pathways, diseases and genes to SF3A2 Antibody (H00008175-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SF3A2 Antibody (H00008175-M01)

Discover more about diseases related to SF3A2 Antibody (H00008175-M01).
 

Pathways for SF3A2 Antibody (H00008175-M01)

View related products by pathway.

Blogs on SF3A2

There are no specific blogs for SF3A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SF3A2 Antibody (3B6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SF3A2
Entrez
OMIM
Uniprot