SF20/MYDGF Recombinant Protein Antigen

Images

 
There are currently no images for SF20/MYDGF Recombinant Protein Antigen (NBP2-48856PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SF20/MYDGF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SF20/MYDGF.

Source: E. coli

Amino Acid Sequence: VSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYDGF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48856.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SF20/MYDGF Recombinant Protein Antigen

  • C19orf10
  • chromosome 19 open reading frame 10
  • EUROIMAGE1875335
  • IL25
  • IL27
  • IL27w
  • interleukin 27 working designation
  • interleukin-25
  • Ly6elg
  • MYDGF
  • myeloid-derived growth factor
  • R33729_1
  • SF20
  • Stromal cell-derived growth factor SF20
  • UPF0556 protein C19orf10

Background

Myeloid-Derived Growth Factor, or MYDGF, is a Bone marrow-derived monocyte protein, and it is correlated with enhanced metabolic activity, suppression of apoptosis, and stimulation of cell proliferation (1). MYDGF is expressed predominantly in inflammatory cells, such as monocytes and macrophages (1). Up-regulation of MYDGF expression was also found during adipocyte differentiation (2). Expression of MYDGF was induced in the circulation and heart tissue after myocardial infarction. It promotes cardiac myocyte survival by stimulating endothelial cell proliferation through a MAPK1/3-, STAT3- and CCND1-mediated signaling pathway, and inhibits cardiac myocyte apoptosis in a PI3K/AKT-dependent signaling pathway (1). MYDGF was found over-expressed in approximately two-thirds of Hepatocellular Carcinoma (HCC) tissues, and its expression was significantly positively correlated with that of alpha-fetoprotein (AFP) (3). In HCC, MYDGF could regulate cell proliferation through activating Akt/mitogen-activated protein kinase pathways (3). Mouse MYDGF shares 92% amino acid sequence identity with both human and rat MYDGF. Intriguingly, virtually all homologs of MYDGF have a C-terminal putative ER retention sequence BXEL (B: Arg, His, or Lys; X: variable residue; E: Glu; L: Leu), which has the potential to retain human MYDGF and its homologs in the ER, whereas truncated MYDGF without BXEL is secreted from the cell (4). However, the functions of these different forms remain unclear.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2274
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
1290-IL
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
DY421
Species: Mu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
485-MI
Species: Mu
Applications: BA
NBP2-27362
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, TCS, WB
NBP2-32691
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-19015
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC,  IHC-P
NBP2-13440
Species: Hu
Applications: IHC,  IHC-P, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP2-02199
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00009527-B01P
Species: Hu
Applications: ICC/IF, WB
NBP2-16197
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
DY1975
Species: Hu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DY413
Species: Mu
Applications: ELISA
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB

Publications for SF20/MYDGF Recombinant Protein Antigen (NBP2-48856PEP) (0)

There are no publications for SF20/MYDGF Recombinant Protein Antigen (NBP2-48856PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SF20/MYDGF Recombinant Protein Antigen (NBP2-48856PEP) (0)

There are no reviews for SF20/MYDGF Recombinant Protein Antigen (NBP2-48856PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SF20/MYDGF Recombinant Protein Antigen (NBP2-48856PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SF20/MYDGF Products

Research Areas for SF20/MYDGF Recombinant Protein Antigen (NBP2-48856PEP)

Find related products by research area.

Blogs on SF20/MYDGF

There are no specific blogs for SF20/MYDGF, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SF20/MYDGF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MYDGF