SEZ6/BSRP-C Antibody

Images

 
Immunohistochemistry: SEZ6/BSRP-C Antibody [NBP1-90945] - Staining of human hippocampus shows cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SEZ6/BSRP-C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PGDVEHSRRLISSPKFPVGATVQYICDQGFVLMGSSILTCHDRQAGSPKWSDRAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATIHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEZ6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SEZ6/BSRP-C Protein (NBP1-90945PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SEZ6/BSRP-C Antibody

  • BSRPC
  • BSRP-C
  • hSEZ-6
  • seizure related 6 homolog (mouse)
  • SEZ6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
H00051268-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
21890002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBL1-12154
Species: Hu
NBP1-84315
Species: Hu
Applications: IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33010
Species: Mu
Applications: WB
NBP2-14040
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SEZ6/BSRP-C Antibody (NBP1-90945) (0)

There are no publications for SEZ6/BSRP-C Antibody (NBP1-90945).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEZ6/BSRP-C Antibody (NBP1-90945) (0)

There are no reviews for SEZ6/BSRP-C Antibody (NBP1-90945). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SEZ6/BSRP-C Antibody (NBP1-90945) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SEZ6/BSRP-C Products

Bioinformatics Tool for SEZ6/BSRP-C Antibody (NBP1-90945)

Discover related pathways, diseases and genes to SEZ6/BSRP-C Antibody (NBP1-90945). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEZ6/BSRP-C Antibody (NBP1-90945)

Discover more about diseases related to SEZ6/BSRP-C Antibody (NBP1-90945).
 

Pathways for SEZ6/BSRP-C Antibody (NBP1-90945)

View related products by pathway.

Blogs on SEZ6/BSRP-C

There are no specific blogs for SEZ6/BSRP-C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SEZ6/BSRP-C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEZ6
Entrez
Uniprot