SETD8 Recombinant Protein Antigen

Images

 
There are currently no images for SETD8 Recombinant Protein Antigen (NBP2-55772PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SETD8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SETD8.

Source: E. coli

Amino Acid Sequence: KDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KMT5A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55772.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SETD8 Recombinant Protein Antigen

  • H4-K20-HMTase KMT5A
  • H4-K20-HMTase SETD8
  • H4K20-specific histone methyltransferase splice variant Set8b
  • Histone-lysine N-methyltransferase SETD8
  • KMT5A SET domain-containing protein 8
  • KMT5A
  • Lysine N-methyltransferase 5A
  • PR/SET domain containing protein 8
  • PR/SET domain-containing protein 07
  • PR/SET07
  • PRSET7
  • PR-Set7
  • PR-Set7EC 2.1.1.43
  • SET domain containing (lysine methyltransferase) 8
  • SET07
  • SET07SET8H4-K20-specific histone methyltransferase
  • SET8
  • SETD8

Background

Histone methyltransferase that specifically monomethylates 'Lys-20' of histone H4. H4 'Lys-20'monomethylation is enriched during mitosis and represents a specific tag for epigenetic transcriptional repression.Mainly functions in euchromatin regions, thereby playing a central role in the silencing of euchromatic genes.Required for cell proliferation, probably by contributing to the maintenance of proper higher order structure of DNAduring mitosis. Involved in chromosome condensation and proper cytokinesis. Nucleosomes are preferred as substratecompared to free histones

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-46113
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
AF5215
Species: Hu, Mu
Applications: ICC, WB
NBL1-11570
Species: Hu
Applications: WB
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
Applications: WB
NB100-40840
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB1207
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB100-56664
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, WB
DBLYS0B
Species: Hu
Applications: ELISA
NB100-304
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, ISH, KD, KO, WB
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC,  IHC-P
MAB4457
Species: Hu, Mu, Rt
Applications: WB

Publications for SETD8 Recombinant Protein Antigen (NBP2-55772PEP) (0)

There are no publications for SETD8 Recombinant Protein Antigen (NBP2-55772PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SETD8 Recombinant Protein Antigen (NBP2-55772PEP) (0)

There are no reviews for SETD8 Recombinant Protein Antigen (NBP2-55772PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SETD8 Recombinant Protein Antigen (NBP2-55772PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SETD8 Products

Research Areas for SETD8 Recombinant Protein Antigen (NBP2-55772PEP)

Find related products by research area.

Blogs on SETD8

There are no specific blogs for SETD8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SETD8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KMT5A