Serum Amyloid A1 Antibody

Images

 
Western Blot: Serum Amyloid A1 Antibody [H00006288-D01P] - Analysis of SAA1 expression in transfected 293T cell line by SAA1 polyclonal antibody.Lane 1: SAA1 transfected lysate(13.50 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Serum Amyloid A1 Antibody Summary

Immunogen
SAA1 (NP_000322.2, 1 a.a. - 122 a.a.) full-length human protein. MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Specificity
Reacts with serum amyloid A1.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SAA1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Serum Amyloid A1 Antibody

  • MGC111216
  • PIG4
  • SAA
  • SAA1
  • SAA2
  • serum amyloid A protein
  • Serum Amyloid A1
  • TP53I4
  • tumor protein p53 inducible protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
AF3856
Species: Hu
Applications: WB, IHC
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF4409
Species: Mu
Applications: WB
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready

Publications for Serum Amyloid A1 Antibody (H00006288-D01P) (0)

There are no publications for Serum Amyloid A1 Antibody (H00006288-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serum Amyloid A1 Antibody (H00006288-D01P) (0)

There are no reviews for Serum Amyloid A1 Antibody (H00006288-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Serum Amyloid A1 Antibody (H00006288-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serum Amyloid A1 Products

Bioinformatics Tool for Serum Amyloid A1 Antibody (H00006288-D01P)

Discover related pathways, diseases and genes to Serum Amyloid A1 Antibody (H00006288-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serum Amyloid A1 Antibody (H00006288-D01P)

Discover more about diseases related to Serum Amyloid A1 Antibody (H00006288-D01P).
 

Pathways for Serum Amyloid A1 Antibody (H00006288-D01P)

View related products by pathway.

PTMs for Serum Amyloid A1 Antibody (H00006288-D01P)

Learn more about PTMs related to Serum Amyloid A1 Antibody (H00006288-D01P).
 

Research Areas for Serum Amyloid A1 Antibody (H00006288-D01P)

Find related products by research area.

Blogs on Serum Amyloid A1

There are no specific blogs for Serum Amyloid A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serum Amyloid A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SAA1
Entrez
Uniprot