Sertad1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Sertad1 Antibody [NBP2-56527] - Staining of human cell line MCF7 shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.

• Reactivity: Hu, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Sertad1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Sertad1 Antibody - BSA Free (NBP2-56527) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TSMYDNELWAPASEGLKPGPEDGPGKEEAPELDEAELDYLMDVLVGTQALERP
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SERTAD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Sertad1 Recombinant Protein Antigen (NBP2-56527PEP)

Reactivity Notes

Rat 89%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Sertad1 Antibody - BSA Free

• SEI-1
• SEI1CDK4-binding protein p34SEI1
• SERTA domain containing 1
• SERTA domain-containing protein 1
• Transcriptional regulator interacting with the PHD-bromodomain 1
• TRIP-Br1CDK4-binding protein p34SEI

Background

Sertad1 is thought to regulate CDK activity and acts as a positive control on cell proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SERTAD1