SERPINB13 Antibody


Immunohistochemistry-Paraffin: SERPINB13 Antibody [NBP2-38821] - Staining of human esophagus shows high expression.
Immunohistochemistry: SERPINB13 Antibody [NBP2-38821] - Staining of human vagina shows nuclear and weak cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: SERPINB13 Antibody [NBP2-38821] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: SERPINB13 Antibody [NBP2-38821] - Staining in human esophagus and colon tissues using anti-SERPINB13 antibody. Corresponding SERPINB13 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

SERPINB13 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PGHMEERKVNLHLPRFEVEDSYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTE
Specificity of human SERPINB13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SERPINB13 Protein (NBP2-38821PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SERPINB13 Antibody

  • HaCaT UV-repressible serpin
  • headpin
  • HUR7
  • MGC126870
  • Peptidase inhibitor 13
  • PI-13
  • PI13hurpin
  • protease inhibitor 13 (hurpin, headpin)
  • Proteinase inhibitor 13
  • serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 13
  • serpin B13
  • serpin peptidase inhibitor, clade B (ovalbumin), member 13
  • UV-B repressed sequence, HUR 7


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Po, Ch, Rb
Applications: WB, IHC, IP
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu
Applications: IHC, IHC-P

Publications for SERPINB13 Antibody (NBP2-38821) (0)

There are no publications for SERPINB13 Antibody (NBP2-38821).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SERPINB13 Antibody (NBP2-38821) (0)

There are no reviews for SERPINB13 Antibody (NBP2-38821). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SERPINB13 Antibody (NBP2-38821) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SERPINB13 Antibody (NBP2-38821)

Discover related pathways, diseases and genes to SERPINB13 Antibody (NBP2-38821). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SERPINB13 Antibody (NBP2-38821)

Discover more about diseases related to SERPINB13 Antibody (NBP2-38821).

Pathways for SERPINB13 Antibody (NBP2-38821)

View related products by pathway.

PTMs for SERPINB13 Antibody (NBP2-38821)

Learn more about PTMs related to SERPINB13 Antibody (NBP2-38821).

Blogs on SERPINB13

There are no specific blogs for SERPINB13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SERPINB13 Antibody and receive a gift card or discount.


Gene Symbol SERPINB13