We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Serpin D1/Heparin Cofactor II Recombinant Protein Antigen

Images

 
There are currently no images for Serpin D1/Heparin Cofactor II Protein (NBP2-33764PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Serpin D1/Heparin Cofactor II Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SERPIND1.

Source: E. coli

Amino Acid Sequence: EAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SERPIND1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33764.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Serpin D1/Heparin Cofactor II Recombinant Protein Antigen

  • HC2
  • HC2LS2
  • HCF2
  • HCF2clade D (heparin cofactor), member 1
  • HC-II
  • Heparin Cofactor II
  • HLS2HCII
  • leuserpin 2
  • LS2
  • Protease inhibitor leuserpin-2
  • Serpin D1
  • serpin peptidase inhibitor, clade D (heparin cofactor), member 1

Background

The product encoded by this gene is a serine proteinase inhibitor which rapidly inhibits thrombin in the presence of dermatan sulfate or heparin. The gene contains five exons and four introns. This protein shares homology with antithrombin III and other members of the alpha 1-antitrypsin superfamily. Mutations in this gene are associated with heparin cofactor II deficiency. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1267
Species: Hu
Applications: IP, Neut, WB
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-87343
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP2-24614
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
AF5110
Species: Mu
Applications: IHC, WB
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-20223
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-48909
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO
NBP2-27461
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
MAB7724
Species: Hu
Applications: ICC, WB
NBP3-48017
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP1-86687
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-82648
Species: Hu
Applications: ICC/IF,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
MAB2104
Species: Hu, Mu
Applications: WB
NBP2-33764PEP
Species: Hu
Applications: AC

Publications for Serpin D1/Heparin Cofactor II Protein (NBP2-33764PEP) (0)

There are no publications for Serpin D1/Heparin Cofactor II Protein (NBP2-33764PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serpin D1/Heparin Cofactor II Protein (NBP2-33764PEP) (0)

There are no reviews for Serpin D1/Heparin Cofactor II Protein (NBP2-33764PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Serpin D1/Heparin Cofactor II Protein (NBP2-33764PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Serpin D1/Heparin Cofactor II Products

Research Areas for Serpin D1/Heparin Cofactor II Protein (NBP2-33764PEP)

Find related products by research area.

Blogs on Serpin D1/Heparin Cofactor II

There are no specific blogs for Serpin D1/Heparin Cofactor II, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Serpin D1/Heparin Cofactor II Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPIND1