Recombinant Human SERCA3 ATPase Protein

Images

 
SDS-Page: Recombinant Human SERCA3 ATPase Protein [H00000489-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SERCA3 ATPase Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 501 - 620 of Human ATP2A3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ATP2A3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00000489-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SERCA3 ATPase Protein

  • adenosine triphosphatase, calcium
  • ATPase, Ca(2+)-transporting, ubiquitous
  • ATPase, Ca++ transporting, ubiquitous
  • Calcium pump 3
  • EC 3.6.3
  • EC 3.6.3.8
  • sarco/endoplasmic reticulum Ca2+ ATPase
  • sarco/endoplasmic reticulum Ca2+ -ATPase
  • sarcoplasmic/endoplasmic reticulum calcium ATPase 3
  • SERCA3calcium-translocating P-type ATPase
  • SR Ca(2+)-ATPase 3

Background

ATP2A3 - ATPase, Ca++ transporting, ubiquitous

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NB300-622
Species: Hu, Mu, Rt, Am, Ca, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NB120-3529
Species: Hu, Rt, Po
Applications: WB, ELISA, IHC-Fr, IHC-P
NB300-569
Species: Hu, Mu, Rt, Po, Am, Bv, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBL1-11664
Species: Hu
NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46376
Species: Hu
Applications: WB, IHC
NB300-578
Species: Hu, Mu, Rt, Po, Am, Ca, Ch, Fe, Ha, Pm, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-90091
Species: Hu
Applications: IHC, IHC-P

Publications for SERCA3 ATPase Partial Recombinant Protein (H00000489-Q01)(1)


Reviews for SERCA3 ATPase Partial Recombinant Protein (H00000489-Q01) (0)

There are no reviews for SERCA3 ATPase Partial Recombinant Protein (H00000489-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SERCA3 ATPase Partial Recombinant Protein (H00000489-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SERCA3 ATPase Products

Bioinformatics Tool for SERCA3 ATPase Partial Recombinant Protein (H00000489-Q01)

Discover related pathways, diseases and genes to SERCA3 ATPase Partial Recombinant Protein (H00000489-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SERCA3 ATPase Partial Recombinant Protein (H00000489-Q01)

Discover more about diseases related to SERCA3 ATPase Partial Recombinant Protein (H00000489-Q01).
 

Pathways for SERCA3 ATPase Partial Recombinant Protein (H00000489-Q01)

View related products by pathway.

PTMs for SERCA3 ATPase Partial Recombinant Protein (H00000489-Q01)

Learn more about PTMs related to SERCA3 ATPase Partial Recombinant Protein (H00000489-Q01).

Blogs on SERCA3 ATPase.

Mending a Broken Heart: New SERCA2 Gene Therapy Fights Heart Disease
While many of the proteins on our antibody database are studied in relation to their expression in diseases; others become therapies in their own right. This is the case with SERCA2 (Sarcoplasmic reticulum Calcium-ATPase 2 pump), which recently hit th...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SERCA3 ATPase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP2A3