SERCA3 ATPase Antibody (1B9)

Images

 
Sandwich ELISA: SERCA3 ATPase Antibody (1B9) [H00000489-M02] - Detection limit for recombinant GST tagged ATP2A3 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SERCA3 ATPase Antibody (1B9) Summary

Immunogen
ATP2A3 (AAH35729, 501 a.a. - 620 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATP2A3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SERCA3 ATPase Antibody (1B9)

  • adenosine triphosphatase, calcium
  • ATPase, Ca(2+)-transporting, ubiquitous
  • ATPase, Ca++ transporting, ubiquitous
  • Calcium pump 3
  • EC 3.6.3
  • EC 3.6.3.8
  • sarco/endoplasmic reticulum Ca2+ ATPase
  • sarco/endoplasmic reticulum Ca2+ -ATPase
  • sarcoplasmic/endoplasmic reticulum calcium ATPase 3
  • SERCA3calcium-translocating P-type ATPase
  • SR Ca(2+)-ATPase 3

Background

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NB300-622
Species: Hu, Mu, Rt, Am, Ca, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NB120-3529
Species: Hu, Rt, Po
Applications: WB, ELISA, IHC-Fr, IHC-P
NB300-569
Species: Hu, Mu, Rt, Po, Am, Bv, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBL1-11664
Species: Hu
NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46376
Species: Hu
Applications: WB, IHC
NB300-578
Species: Hu, Mu, Rt, Po, Am, Ca, Ch, Fe, Ha, Pm, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-90091
Species: Hu
Applications: IHC, IHC-P

Publications for SERCA3 ATPase Antibody (H00000489-M02) (0)

There are no publications for SERCA3 ATPase Antibody (H00000489-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SERCA3 ATPase Antibody (H00000489-M02) (0)

There are no reviews for SERCA3 ATPase Antibody (H00000489-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SERCA3 ATPase Antibody (H00000489-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SERCA3 ATPase Products

Bioinformatics Tool for SERCA3 ATPase Antibody (H00000489-M02)

Discover related pathways, diseases and genes to SERCA3 ATPase Antibody (H00000489-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SERCA3 ATPase Antibody (H00000489-M02)

Discover more about diseases related to SERCA3 ATPase Antibody (H00000489-M02).
 

Pathways for SERCA3 ATPase Antibody (H00000489-M02)

View related products by pathway.

PTMs for SERCA3 ATPase Antibody (H00000489-M02)

Learn more about PTMs related to SERCA3 ATPase Antibody (H00000489-M02).

Blogs on SERCA3 ATPase.

Mending a Broken Heart: New SERCA2 Gene Therapy Fights Heart Disease
While many of the proteins on our antibody database are studied in relation to their expression in diseases; others become therapies in their own right. This is the case with SERCA2 (Sarcoplasmic reticulum Calcium-ATPase 2 pump), which recently hit th...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SERCA3 ATPase Antibody (1B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP2A3
Uniprot