SERCA2 ATPase Recombinant Protein Antigen

Images

 
There are currently no images for SERCA2 ATPase Recombinant Protein Antigen (NBP2-57446PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SERCA2 ATPase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SERCA2 ATPase.

Source: E. coli

Amino Acid Sequence: AWWFIAADGGPRVSFYQLSHFLQCKEDNPDFE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP2A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57446.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SERCA2 ATPase Recombinant Protein Antigen

  • ATP2A2
  • ATP2B
  • ATP2BFLJ20293
  • ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2
  • ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
  • Calcium pump 2
  • Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletalmuscle isoform
  • cardiac Ca2+ ATPase
  • DAR
  • DD
  • EC 3.6.3
  • EC 3.6.3.8
  • Endoplasmic reticulum class 1/2 Ca(2+) ATPase
  • FLJ38063
  • MGC45367
  • sarcoplasmic/endoplasmic reticulum calcium ATPase 2
  • SERCA2 ATPase
  • SERCA2
  • SERCA2DKFZp686P0211
  • SR Ca(2+)-ATPase 2

Background

Sarcoplasmic/endoplasmic reticulum Calcium-ATPase 2 (SERCA2) is a magnesium-dependent pump that catalyzes the hydrolysis of ATP and translocates calcium from the cytosol to the sarcoplasmic reticulum lumen. There are 2 SERCA2 isoforms that differ in the 3' UTR. The SERCA2A isoform is highly expressed in heart and slow twitch skeletal muscle and is important to the regulation of the contraction and relaxation cycle, while the SERCA2B isoform is expressed in smooth muscle and adult epidermis. SERCA2 is also known as ATP2A2, ATP2B, DAR, DD, and MGC45367.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
AF4377
Species: Hu, Mu
Applications: ICC, Simple Western, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
AF6989
Species: Mu
Applications: IHC
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-19807
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
664-LI
Species: Hu
Applications: BA
MAB5745
Species: Hu
Applications: IHC, WB
NBP1-86125
Species: Hu
Applications: IHC,  IHC-P
H00000487-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-49409
Species: Hu
Applications: IHC,  IHC-P
AF1148
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-89200
Species: Hu, Mu
Applications: IHC,  IHC-P, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
DSE100
Species: Hu
Applications: ELISA
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for SERCA2 ATPase Recombinant Protein Antigen (NBP2-57446PEP) (0)

There are no publications for SERCA2 ATPase Recombinant Protein Antigen (NBP2-57446PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SERCA2 ATPase Recombinant Protein Antigen (NBP2-57446PEP) (0)

There are no reviews for SERCA2 ATPase Recombinant Protein Antigen (NBP2-57446PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SERCA2 ATPase Recombinant Protein Antigen (NBP2-57446PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SERCA2 ATPase Products

Research Areas for SERCA2 ATPase Recombinant Protein Antigen (NBP2-57446PEP)

Find related products by research area.

Blogs on SERCA2 ATPase.

Mending a Broken Heart: New SERCA2 Gene Therapy Fights Heart Disease
While many of the proteins on our antibody database are studied in relation to their expression in diseases; others become therapies in their own right. This is the case with SERCA2 (Sarcoplasmic reticulum Calcium-ATPase 2 pump), which recently hit th...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SERCA2 ATPase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP2A2