Septin-7 Antibody

Images

 
Western Blot: Septin-7 Antibody [NBP1-85730] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Septin-7 Antibody [NBP1-85730] - Staining of human cell line U-2 OS shows localization to actin filaments & midbody. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining in human cerebral cortex and skeletal muscle tissues. Corresponding SEPT7 RNA-seq data are presented for the same ...read more
Western Blot: Septin-7 Antibody [NBP1-85730] - Analysis in human cell line NTERA-2.
Immunocytochemistry/ Immunofluorescence: Septin-7 Antibody [NBP1-85730] - Staining of human cell line U-2 OS shows localization to actin filaments and midbody. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining of human cerebral cortex shows positivity in neuropil.
Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining of human lymph node shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining of human testis shows positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Septin-7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESG
Specificity
Specificity of human, mouse, rat Septin-7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEPT7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Septin-7 Protein (NBP1-85730PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Septin-7 Antibody

  • CDC10 cell division cycle 10 homolog (S. cerevisiae)
  • CDC10 cell division cycle 10 homolog
  • CDC10 protein homolog
  • CDC10S. cerevisiae, homolog)
  • Nbla02942
  • septin 7
  • septin-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89626
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85212
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89787
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90339
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84251
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33506
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7357
Species: Hu
Applications: WB
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-97492
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fi, GP, Ha, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Septin-7 Antibody (NBP1-85730) (0)

There are no publications for Septin-7 Antibody (NBP1-85730).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Septin-7 Antibody (NBP1-85730) (0)

There are no reviews for Septin-7 Antibody (NBP1-85730). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Septin-7 Antibody (NBP1-85730) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Septin-7 Products

Bioinformatics Tool for Septin-7 Antibody (NBP1-85730)

Discover related pathways, diseases and genes to Septin-7 Antibody (NBP1-85730). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Septin-7 Antibody (NBP1-85730)

Discover more about diseases related to Septin-7 Antibody (NBP1-85730).
 

Pathways for Septin-7 Antibody (NBP1-85730)

View related products by pathway.

PTMs for Septin-7 Antibody (NBP1-85730)

Learn more about PTMs related to Septin-7 Antibody (NBP1-85730).
 

Research Areas for Septin-7 Antibody (NBP1-85730)

Find related products by research area.

Blogs on Septin-7

There are no specific blogs for Septin-7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Septin-7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SEPT7
Entrez
Uniprot