Septin-7 Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining in human cerebral cortex and skeletal muscle tissues . Corresponding SEPT7 RNA-seq data are presented for the same ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining of human cerebral cortex, lymph node, skeletal muscle and testis using Anti-SEPT7 antibody NBP1-85730 (A) shows ...read more
Immunocytochemistry/ Immunofluorescence: Septin-7 Antibody [NBP1-85730] - Staining of human cell line U-2 OS shows localization to actin filaments & midbody. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining of human cerebral cortex shows positivity in neuropil.
Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining of human lymph node shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining of human testis shows positivity in cells in seminiferous ducts.
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Analysis in human cell line NTERA-2.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

Septin-7 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit Septin-7 Antibody - BSA Free (NBP1-85730) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SEPTIN7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Septin-7 Protein (NBP1-85730PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Septin-7 Antibody - BSA Free

  • CDC10 cell division cycle 10 homolog (S. cerevisiae)
  • CDC10 cell division cycle 10 homolog
  • CDC10 protein homolog
  • CDC10S. cerevisiae, homolog)
  • Nbla02942
  • septin 7
  • septin-7

Background

This gene encodes a protein that is highly similar to the CDC10 protein of Saccharomyces cerevisiae. The protein also shares similarity with Diff 6 of Drosophila and with H5 of mouse. Each of these similar proteins, including the yeast CDC10, contains a GTP-binding motif. The yeast CDC10 protein is a structural component of the 10 nm filament which lies inside the cytoplasmic membrane and is essential for cytokinesis. Although the exact function of this gene has not yet been determined, its high similarity to yeast CDC10 and the high conservative nature of eukaryotic cell cycle machinery suggest a similar role to that of its yeast counterpart. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89787
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
H00010097-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP2-71688
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-33506
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3847
Species: Hu
Applications: ICC, WB
NBP1-97492
Species: Bv, Ca, Ch, Fi, Gp, Ha, Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-85730
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for Septin-7 Antibody (NBP1-85730) (0)

There are no publications for Septin-7 Antibody (NBP1-85730).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Septin-7 Antibody (NBP1-85730) (0)

There are no reviews for Septin-7 Antibody (NBP1-85730). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Septin-7 Antibody (NBP1-85730) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Septin-7 Products

Research Areas for Septin-7 Antibody (NBP1-85730)

Find related products by research area.

Blogs on Septin-7

There are no specific blogs for Septin-7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Septin-7 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SEPTIN7
Entrez
Uniprot